Sequence:
download
ENSEMBL:ENSP00000347504sequence.fasta
>ITGB1BP1 MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGK GLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTT DASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP
view sequence (200 aa)
>ITGB1BP1
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGK
GLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTT
DASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP
Estimated Isoelectric Point:
5.94924163818359
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr10
Lys17
Gln8
Leu20
Gly14
Met3
Ser32
Tyr8
His3
Glu12
Arg6
Cys4
Phe5
Pro5
Val12
Asn6
Ala11
Ile10
Trp1
Asp13