Sequence:
download
ENSEMBL:ENSP00000344942sequence.fasta
>UNC119B MSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRPEHVLRLSRVT ENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFVRYQFTPAFLRLRTVGATVEF TVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLIMH NKADYAYNGGQ
view sequence (251 aa)
>UNC119B
MSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRPEHVLRLSRVT
ENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFVRYQFTPAFLRLRTVGATVEF
TVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLIMH
NKADYAYNGGQ
Estimated Isoelectric Point:
5.45459747314453
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys13
Gln6
Leu18
Gly20
Met4
Ser13
Tyr9
His7
Glu22
Arg18
Cys4
Phe16
Pro11
Val16
Asn11
Ala22
Ile12
Asp17