Sequence:
download
ENSEMBL:ENSP00000343517sequence.fasta
>angiopoietin-2 MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRL QVLENIMENNTQWLMKVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEE KDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGH TTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLK IHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGP SNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
view sequence (444 aa)
>angiopoietin-2
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRL
QVLENIMENNTQWLMKVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEE
KDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGH
TTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLK
IHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGP
SNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Estimated Isoelectric Point:
5.73967742919922
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr28
Lys34
Gln31
Leu41
Gly26
Met14
Ser39
Tyr19
His8
Glu31
Arg13
Cys9
Phe16
Pro10
Val21
Asn31
Ala17
Ile23
Trp10
Asp23