Sequence:
download
ENSEMBL:ENSP00000343244sequence.fasta
>DUSP21 MTASASSFSSSQGVQQPSIYSFSQITRSLFLSNGVAANDKLLLSSNRITAIVNASVEVVNVFFEGIQYIKVPVTDARDSR LYDFFDPIADLIHTIDMRQGRTLLHCMAGVSRSASLCLAYLMKYHSMSLLDAHTWTKSRRPIIRPNNGFWEQLINYEFKL FNNNTVRMINSPVGNIPDIYEKDLRMMISM
view sequence (190 aa)
>DUSP21
MTASASSFSSSQGVQQPSIYSFSQITRSLFLSNGVAANDKLLLSSNRITAIVNASVEVVNVFFEGIQYIKVPVTDARDSR
LYDFFDPIADLIHTIDMRQGRTLLHCMAGVSRSASLCLAYLMKYHSMSLLDAHTWTKSRRPIIRPNNGFWEQLINYEFKL
FNNNTVRMINSPVGNIPDIYEKDLRMMISM
Estimated Isoelectric Point:
8.94957733154297
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys6
Gln7
Leu17
Gly7
Met9
Ser23
Tyr7
His4
Glu5
Arg12
Cys2
Phe10
Pro7
Val12
Asn13
Ala12
Ile16
Trp2
Asp10