Sequence:
download
ENSEMBL:ENSP00000337446sequence.fasta
>STARD3 MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNTNTGIRK NLEQEIIQYNFKTSFFDIFVLAFFRFSGLLLGYAVLRLRHWWVIAVTTLVSSAFLIVKVILSELLSKGAFGYLLPIVSFV LAWLETWFLDFKVLPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIR QGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQIL QRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVC TFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGARA
view sequence (445 aa)
>STARD3
MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNTNTGIRK
NLEQEIIQYNFKTSFFDIFVLAFFRFSGLLLGYAVLRLRHWWVIAVTTLVSSAFLIVKVILSELLSKGAFGYLLPIVSFV
LAWLETWFLDFKVLPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIR
QGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQIL
QRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVC
TFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGARA
Estimated Isoelectric Point:
8.52585601806641
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr22
Lys19
Gln16
Leu54
Gly24
Met3
Ser38
Tyr13
His8
Glu33
Arg31
Cys4
Phe30
Pro20
Val34
Asn14
Ala34
Ile25
Trp9
Asp14