Sequence:
download
ENSEMBL:ENSP00000333917sequence.fasta
>DUSP18 MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLC DFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFG KNTVHMVSSPVGMIPDIYEKEVRLMIPL
view sequence (188 aa)
>DUSP18
MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLC
DFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFG
KNTVHMVSSPVGMIPDIYEKEVRLMIPL
Estimated Isoelectric Point:
7.03679656982422
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr8
Lys7
Gln9
Leu17
Gly7
Met10
Ser19
Tyr7
His7
Glu7
Arg7
Cys5
Phe7
Pro11
Val16
Asn9
Ala13
Ile13
Trp2
Asp7