Sequence:
download
ENSEMBL:ENSP00000332287sequence.fasta
>SYNGR1 MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFL TCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFT WAGQAVLAFQRYQIGADSALFSQDYMDPSQDSSMPYAPYVEPTGPDPAGMGGTYQQPANTFDTEPQGYQSQGY
view sequence (233 aa)
>SYNGR1
MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFL
TCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFT
WAGQAVLAFQRYQIGADSALFSQDYMDPSQDSSMPYAPYVEPTGPDPAGMGGTYQQPANTFDTEPQGYQSQGY
Estimated Isoelectric Point:
4.49788665771484
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys6
Gln14
Leu16
Gly22
Met4
Ser19
Tyr15
His1
Glu8
Arg6
Cys4
Phe17
Pro14
Val17
Asn9
Ala26
Ile9
Trp5
Asp12