Sequence:
download
ENSEMBL:ENSP00000327652sequence.fasta
>DRD1 MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPW KAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQ LSWHKAKPTSPSDGNATSLAETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGSGETQPFCIDSNTFDVFVWFG WANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSED LKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT
view sequence (446 aa)
>DRD1
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPW
KAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQ
LSWHKAKPTSPSDGNATSLAETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGSGETQPFCIDSNTFDVFVWFG
WANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSED
LKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT
Estimated Isoelectric Point:
8.63576507568359
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr29
Lys19
Gln9
Leu41
Gly18
Met9
Ser47
Tyr10
His7
Glu17
Arg20
Cys16
Phe27
Pro21
Val34
Asn21
Ala39
Ile38
Trp9
Asp15