Sequence:
download
ENSEMBL:ENSP00000325379sequence.fasta
>RTKN2 MEGPSLRGPALRLAGLPTQQDCNIQEKIDLEIRMREGIWKLLSLSTQKDQVLHAVKNLMVCNARLMAYTSELQKLEEQIA NQTGRCDVKFESKERTACKGKIAISDIRIPLMWKDSDHFSNKERSRRYAIFCLFKMGANVFDTDVVNVDKTITDICFENV TIFNEAGPDFQIKVEVYSCCTEESSITNTPKKLAKKLKTSISKATGKKISSVLQEEDDEMCLLLSSAVFGVKYNLLAHTT LTLESAEDSFKTHNLSINGNEESSFWLPLYGNMCCRLVAQPACMAEDAFAGFLNQQQMVEGLISWRRLYCVLRGGKLYCF YSPEEIEAKVEPALVVPINKSLVLFEDSLEGIQLAISQSFKETRIRAMDKDAKKRIHNFSVINPVPGQAITQIFAVDNRE DLQKWMEAFWQHFFDLSQWKHCCEELMKIEIMSPRKPPLFLTKEATSVYHDMSIDSPMKLESLTDIIQKKIEETNGQFLI GQHEESLPPPWATLFDGNHQMVIQKKNNSNQLHNLQKLPATSKFLFT
view sequence (527 aa)
>RTKN2
MEGPSLRGPALRLAGLPTQQDCNIQEKIDLEIRMREGIWKLLSLSTQKDQVLHAVKNLMVCNARLMAYTSELQKLEEQIA
NQTGRCDVKFESKERTACKGKIAISDIRIPLMWKDSDHFSNKERSRRYAIFCLFKMGANVFDTDVVNVDKTITDICFENV
TIFNEAGPDFQIKVEVYSCCTEESSITNTPKKLAKKLKTSISKATGKKISSVLQEEDDEMCLLLSSAVFGVKYNLLAHTT
LTLESAEDSFKTHNLSINGNEESSFWLPLYGNMCCRLVAQPACMAEDAFAGFLNQQQMVEGLISWRRLYCVLRGGKLYCF
YSPEEIEAKVEPALVVPINKSLVLFEDSLEGIQLAISQSFKETRIRAMDKDAKKRIHNFSVINPVPGQAITQIFAVDNRE
DLQKWMEAFWQHFFDLSQWKHCCEELMKIEIMSPRKPPLFLTKEATSVYHDMSIDSPMKLESLTDIIQKKIEETNGQFLI
GQHEESLPPPWATLFDGNHQMVIQKKNNSNQLHNLQKLPATSKFLFT
Estimated Isoelectric Point:
6.18625640869141
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr27
Lys43
Gln28
Leu53
Gly21
Met17
Ser39
Tyr9
His11
Glu42
Arg20
Cys16
Phe26
Pro21
Val26
Asn26
Ala32
Ile36
Trp8
Asp26