Sequence:
download
ENSEMBL:ENSP00000318912sequence.fasta
>CA13 MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVL RGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQK ITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAA FLVSNHRPPQPLKGRKVRASFH
view sequence (262 aa)
>CA13
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVL
RGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQK
ITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAA
FLVSNHRPPQPLKGRKVRASFH
Estimated Isoelectric Point:
6.45178985595703
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys16
Gln11
Leu26
Gly17
Met1
Ser29
Tyr8
His12
Glu14
Arg11
Cys1
Phe11
Pro18
Val16
Asn9
Ala14
Ile14
Trp7
Asp16