Sequence:
download
ENSEMBL:ENSP00000310814sequence.fasta
>STARD6 MDFKAIAQQTAQEVLGYNRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQTGDRITWDKSLQV YNMVHRIDSDTFICHTITQSFAVGSISPRDFIDLVYIKRYEGNMNIISSKSVDFPEYPPSSNYIRGYNHPCGFVCSPMEE NPAYSKLVMFVQTEMRGKLSPSIIEKTMPSNLVNFILNAKDGIKAHRTPSRRGFHHNSHS
view sequence (220 aa)
>STARD6
MDFKAIAQQTAQEVLGYNRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQTGDRITWDKSLQV
YNMVHRIDSDTFICHTITQSFAVGSISPRDFIDLVYIKRYEGNMNIISSKSVDFPEYPPSSNYIRGYNHPCGFVCSPMEE
NPAYSKLVMFVQTEMRGKLSPSIIEKTMPSNLVNFILNAKDGIKAHRTPSRRGFHHNSHS
Estimated Isoelectric Point:
9.36432647705078
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys16
Gln7
Leu10
Gly12
Met7
Ser25
Tyr10
His8
Glu9
Arg12
Cys3
Phe11
Pro12
Val14
Asn12
Ala9
Ile18
Trp2
Asp11