Sequence:
download
ENSEMBL:ENSP00000309503sequence.fasta
>YWHAZ MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAR EYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEM QPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG EGGEN
view sequence (245 aa)
>YWHAZ
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAR
EYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEM
QPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
Estimated Isoelectric Point:
4.72624969482422
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr10
Lys20
Gln14
Leu24
Gly11
Met7
Ser19
Tyr11
His1
Glu30
Arg11
Cys3
Phe6
Pro4
Val12
Asn10
Ala25
Ile10
Trp2
Asp15