Sequence:
download
ENSEMBL:ENSP00000307132sequence.fasta
>CST5 MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVG GVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV
view sequence (142 aa)
>CST5
MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVG
GVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV
Estimated Isoelectric Point:
6.70621490478516
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr7
Lys10
Gln8
Leu12
Gly6
Met5
Ser9
Tyr7
His2
Glu7
Arg4
Cys5
Phe6
Pro7
Val10
Asn10
Ala11
Ile7
Trp2
Asp7