Sequence:
download
ENSEMBL:ENSP00000306330sequence.fasta
>YWHAG MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIE MVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEI SKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD DGGEGNN
view sequence (247 aa)
>YWHAG
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIE
MVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEI
SKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
Estimated Isoelectric Point:
4.80059051513672
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys17
Gln12
Leu24
Gly8
Met7
Ser18
Tyr14
His4
Glu28
Arg13
Cys3
Phe3
Pro4
Val15
Asn14
Ala23
Ile10
Trp2
Asp17