Sequence:
download
ENSEMBL:ENSP00000305810sequence.fasta
>STX18 MAVDITLLFRASVKTVKTRNKALGVAVGGGVDGSRDELFRRSPRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSH TMSEYGRMTDTERDQIDQDAQIFMRTCSEAIQQLRTEAHKEIHSQQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRV VDKKRLSKLEPEPNTKTRESTSSEKVSQSPSKDSEENPATEERPEKILAETQPELGTWGDGKGEDELSPEEIQMFEQENQ RLIGEMNSLFDEVRQIEGRVVEISRLQEIFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNNAGFRVWILFFL VMCSFSLLFLDWYDS
view sequence (335 aa)
>STX18
MAVDITLLFRASVKTVKTRNKALGVAVGGGVDGSRDELFRRSPRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSH
TMSEYGRMTDTERDQIDQDAQIFMRTCSEAIQQLRTEAHKEIHSQQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRV
VDKKRLSKLEPEPNTKTRESTSSEKVSQSPSKDSEENPATEERPEKILAETQPELGTWGDGKGEDELSPEEIQMFEQENQ
RLIGEMNSLFDEVRQIEGRVVEISRLQEIFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNNAGFRVWILFFL
VMCSFSLLFLDWYDS
Estimated Isoelectric Point:
5.35996246337891
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr17
Lys22
Gln18
Leu26
Gly17
Met7
Ser26
Tyr6
His7
Glu40
Arg28
Cys3
Phe14
Pro9
Val22
Asn10
Ala17
Ile22
Trp3
Asp21