Sequence:
download
ENSEMBL:ENSP00000304032sequence.fasta
>STARD5 MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGLRVKWD ENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFC EPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE
view sequence (213 aa)
>STARD5
MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGLRVKWD
ENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFC
EPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE
Estimated Isoelectric Point:
6.21263885498047
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys10
Gln6
Leu15
Gly16
Met5
Ser14
Tyr6
His5
Glu14
Arg12
Cys7
Phe12
Pro16
Val20
Asn8
Ala12
Ile7
Trp4
Asp10