Sequence:
download
ENSEMBL:ENSP00000302456sequence.fasta
>KLF13 MAAAAYVDHFAAECLVSMSSRAVVHGPREGPESRPEGAAVAATPTLPRVEERRDGKDSASLFVVARILADLNQQAPAPAP AERREGAAARKARTPCRLPPPAPEPTSPGAEGAAAAPPSPAWSEPEPEAGLEPEREPGPAGSGEPGLRQRVRRGRSRADL ESPQRKHKCHYAGCEKVYGKSSHLKAHLRTHTGERPFACSWQDCNKKFARSDELARHYRTHTGEKKFSCPICEKRFMRSD HLTKHARRHANFHPGMLQRRGGGSRTGSLSDYSRSDASSPTISPASSP
view sequence (288 aa)
>KLF13
MAAAAYVDHFAAECLVSMSSRAVVHGPREGPESRPEGAAVAATPTLPRVEERRDGKDSASLFVVARILADLNQQAPAPAP
AERREGAAARKARTPCRLPPPAPEPTSPGAEGAAAAPPSPAWSEPEPEAGLEPEREPGPAGSGEPGLRQRVRRGRSRADL
ESPQRKHKCHYAGCEKVYGKSSHLKAHLRTHTGERPFACSWQDCNKKFARSDELARHYRTHTGEKKFSCPICEKRFMRSD
HLTKHARRHANFHPGMLQRRGGGSRTGSLSDYSRSDASSPTISPASSP
Estimated Isoelectric Point:
9.63018035888672
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys13
Gln6
Leu15
Gly22
Met4
Ser28
Tyr5
His13
Glu23
Arg33
Cys8
Phe7
Pro31
Val10
Asn3
Ala41
Ile3
Trp2
Asp10