Sequence:
download
ENSEMBL:ENSP00000296632sequence.fasta
>STARD4 MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGPCRLDWD SLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDEKRPEFVRGYNHPCGWFCVPL KDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL
view sequence (205 aa)
>STARD4
MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGPCRLDWD
SLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDEKRPEFVRGYNHPCGWFCVPL
KDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL
Estimated Isoelectric Point:
5.12230682373047
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr13
Lys12
Gln6
Leu20
Gly13
Met5
Ser14
Tyr10
His3
Glu12
Arg10
Cys6
Phe8
Pro9
Val12
Asn9
Ala9
Ile12
Trp6
Asp16