Sequence:
download
ENSEMBL:ENSP00000278193sequence.fasta
>LIN7C MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVA AFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELL KAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT
view sequence (197 aa)
>LIN7C
MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVA
AFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELL
KAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT
Estimated Isoelectric Point:
8.52040863037109
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr6
Lys13
Gln10
Leu17
Gly15
Met4
Ser13
Tyr4
His6
Glu23
Arg16
Cys2
Phe4
Pro9
Val19
Asn5
Ala18
Ile9
Asp4