Sequence:
download
ENSEMBL:ENSP00000274625sequence.fasta
>FGF18 MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDG DKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPR KGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA
view sequence (207 aa)
>FGF18
MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDG
DKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPR
KGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA
Estimated Isoelectric Point:
9.85950469970703
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys20
Gln12
Leu17
Gly14
Met4
Ser11
Tyr10
His5
Glu12
Arg19
Cys6
Phe9
Pro9
Val15
Asn6
Ala9
Ile6
Trp1
Asp8