Sequence:
download
ENSEMBL:ENSP00000262187sequence.fasta
>RHEB MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDING YILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVF RRIILEAEKMDGAASQGKSSCSVM
view sequence (184 aa)
>RHEB
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDING
YILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVF
RRIILEAEKMDGAASQGKSSCSVM
Estimated Isoelectric Point:
5.64995574951172
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys14
Gln10
Leu13
Gly12
Met6
Ser19
Tyr8
His3
Glu13
Arg5
Cys1
Phe7
Pro4
Val16
Asn6
Ala11
Ile17
Trp1
Asp9