Sequence:
download
ENSEMBL:ENSP00000258301sequence.fasta
>STX6 MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETISIVEANPRKFNL DATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQA QQQLIVEQQDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAI LFAVLLVVLILFLVL
view sequence (255 aa)
>STX6
MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETISIVEANPRKFNL
DATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQA
QQQLIVEQQDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAI
LFAVLLVVLILFLVL
Estimated Isoelectric Point:
4.84117889404297
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys11
Gln22
Leu30
Gly10
Met8
Ser21
Tyr1
His3
Glu24
Arg17
Cys1
Phe9
Pro3
Val18
Asn11
Ala16
Ile13
Trp5
Asp16