Sequence:
download
ENSEMBL:ENSP00000252603sequence.fasta
>PGLS MAAPAPGLISVFSSSQELGAALAQLVAQRAACCLAGARARFALGLSGGSLVSMLARELPAAVAPAGPASLARWTLGFCDE RLVPFDHAESTYGLYRTHLLSRLPIPESQVITINPELPVEEAAEDYAKKLRQAFQGDSIPVFDLLILGVGPDGHTCSLFP DHPLLQEREKIVAPISDSPKPPPQRVTLTLPVLNAARTVIFVATGEGKAAVLKRILEDQEENPLPAALVQPHTGKLCWFL DEAAARLLTVPFEKHSTL
view sequence (258 aa)
>PGLS
MAAPAPGLISVFSSSQELGAALAQLVAQRAACCLAGARARFALGLSGGSLVSMLARELPAAVAPAGPASLARWTLGFCDE
RLVPFDHAESTYGLYRTHLLSRLPIPESQVITINPELPVEEAAEDYAKKLRQAFQGDSIPVFDLLILGVGPDGHTCSLFP
DHPLLQEREKIVAPISDSPKPPPQRVTLTLPVLNAARTVIFVATGEGKAAVLKRILEDQEENPLPAALVQPHTGKLCWFL
DEAAARLLTVPFEKHSTL
Estimated Isoelectric Point:
5.70261383056641
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys8
Gln10
Leu37
Gly16
Met2
Ser16
Tyr3
His6
Glu17
Arg14
Cys5
Phe10
Pro24
Val17
Asn3
Ala36
Ile10
Trp2
Asp10