Sequence:
download
ENSEMBL:ENSP00000250405sequence.fasta
>BCL2L2 MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEAR RLREGNWASVRTVLTGAVALGALVTVGAFFASK
view sequence (193 aa)
>BCL2L2
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
Estimated Isoelectric Point:
5.21202850341797
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys4
Gln10
Leu17
Gly21
Met4
Ser9
Tyr4
His3
Glu13
Arg12
Cys2
Phe12
Pro8
Val16
Asn3
Ala30
Ile1
Trp5
Asp8