Sequence:
download
ENSEMBL:ENSP00000240285sequence.fasta
>RDH10 MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRRALLVLWDINTQSNEETAGMV RHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVGKRENVYLTAERVRKEVGEVSVLVNNAGVVSGHHLLECPDE LIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTL VCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTFMKSILPFEAVVCMYRFLGADKC MYPFIAQRKQATNNNEAKNGI
view sequence (341 aa)
>RDH10
MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRRALLVLWDINTQSNEETAGMV
RHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVGKRENVYLTAERVRKEVGEVSVLVNNAGVVSGHHLLECPDE
LIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTL
VCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTFMKSILPFEAVVCMYRFLGADKC
MYPFIAQRKQATNNNEAKNGI
Estimated Isoelectric Point:
7.11156463623047
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr20
Lys18
Gln8
Leu33
Gly22
Met12
Ser12
Tyr9
His10
Glu25
Arg18
Cys12
Phe18
Pro13
Val33
Asn14
Ala32
Ile17
Trp4
Asp11