Sequence:
download
ENSEMBL:ENSP00000238081sequence.fasta
>YWHAQ MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIK DYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEM QPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA EGAEN
view sequence (245 aa)
>YWHAQ
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIK
DYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEM
QPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
Estimated Isoelectric Point:
4.68341827392578
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys19
Gln10
Leu27
Gly9
Met6
Ser16
Tyr11
His1
Glu26
Arg11
Cys5
Phe6
Pro4
Val10
Asn12
Ala24
Ile12
Trp2
Asp18