Sequence:
download
ENSEMBL:ENSP00000237316sequence.fasta
>TCF21 MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRRKAPTKKSPLSGVSQEGKQVQ RNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKP ESDLKEVVTASRLCGTTAS
view sequence (179 aa)
>TCF21
MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRRKAPTKKSPLSGVSQEGKQVQ
RNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKP
ESDLKEVVTASRLCGTTAS
Estimated Isoelectric Point:
9.15123748779297
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys15
Gln6
Leu18
Gly12
Met5
Ser20
Tyr3
His2
Glu14
Arg12
Cys3
Phe3
Pro9
Val11
Asn9
Ala12
Ile3
Trp2
Asp8