Sequence:
download
ENSEMBL:ENSP00000222812sequence.fasta
>STX1A MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMS DIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTT TSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHA VDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIVIASTVGGIFA
view sequence (288 aa)
>STX1A
MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMS
DIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTT
TSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHA
VDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIVIASTVGGIFA
Estimated Isoelectric Point:
5.13800811767578
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr15
Lys23
Gln11
Leu16
Gly10
Met12
Ser26
Tyr5
His5
Glu35
Arg22
Cys3
Phe8
Pro3
Val18
Asn8
Ala18
Ile28
Asp22