Sequence:
download
ENSEMBL:ENSP00000221459sequence.fasta
>LIN7B MAALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGSAEIRAHATAKATVA AFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELL KAAQGSVKLVVRYTPRVLEEMEARFEKMRSARRRQQHQSYSSLESRG
view sequence (207 aa)
>LIN7B
MAALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGSAEIRAHATAKATVA
AFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELL
KAAQGSVKLVVRYTPRVLEEMEARFEKMRSARRRQQHQSYSSLESRG
Estimated Isoelectric Point:
8.70967864990234
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr7
Lys9
Gln13
Leu22
Gly17
Met4
Ser16
Tyr5
His6
Glu21
Arg20
Cys1
Phe4
Pro8
Val18
Asn3
Ala20
Ile7
Asp6