Sequence:
download
ENSEMBL:ENSP00000215773sequence.fasta
>DDT MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAH FFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
view sequence (118 aa)
>DDT
MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAH
FFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
Estimated Isoelectric Point:
6.71817779541016
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr7
Lys4
Gln3
Leu15
Gly9
Met3
Ser9
His2
Glu7
Arg7
Cys2
Phe7
Pro7
Val7
Asn4
Ala13
Ile7
Trp1
Asp4