Sequence:
download
Cni-trxr-2sequence.fasta
>Cni-trxr-2 MLLQAKQPTARLLSTAIQYDMIVIGGGSGGLSCSKRAAELGAKVALVDAVEPTPNGYSWGIGGTCANVGCIPKKLMHQAA IVGKELKTAEKYGWKGLDQSKISHNWSTLTKVVNDRIKGNNWVYKVQLRDMGIKYYNAFAEFVEGGNVLVTTADKKKTQT LLSAPNIILATGLRPRYPDVPGALLGITSDDLFTLSKPPGKVLVVGAGYVALECAGFLAGVNQDVEVLIRSRPLKEFDKD CVNFVMGQLKSTGVKVKEGVEVAKVEEVGNGKKKVYFTENGGVEEYDTVIWAAGREPRMEKLKLDYVGVKRNSKSGKILA DEYDKTSVEGIYAVGDIVEGRLELTPLAIQSGRLLAERLFAGSKQTVRFDGIATTVFTPLELSTVGLTEEEAKKKYGEDG IEVYHSHYTPFEYIVPQNEDKAYCYVKAICLRDDTQKVVGLHFVGPNAAEVMQGYAVAFRVGISISDLQLTVAIHPCSSE EFVKLQITKRSGKDPRVQGCCG
view sequence (502 aa)
>Cni-trxr-2
MLLQAKQPTARLLSTAIQYDMIVIGGGSGGLSCSKRAAELGAKVALVDAVEPTPNGYSWGIGGTCANVGCIPKKLMHQAA
IVGKELKTAEKYGWKGLDQSKISHNWSTLTKVVNDRIKGNNWVYKVQLRDMGIKYYNAFAEFVEGGNVLVTTADKKKTQT
LLSAPNIILATGLRPRYPDVPGALLGITSDDLFTLSKPPGKVLVVGAGYVALECAGFLAGVNQDVEVLIRSRPLKEFDKD
CVNFVMGQLKSTGVKVKEGVEVAKVEEVGNGKKKVYFTENGGVEEYDTVIWAAGREPRMEKLKLDYVGVKRNSKSGKILA
DEYDKTSVEGIYAVGDIVEGRLELTPLAIQSGRLLAERLFAGSKQTVRFDGIATTVFTPLELSTVGLTEEEAKKKYGEDG
IEVYHSHYTPFEYIVPQNEDKAYCYVKAICLRDDTQKVVGLHFVGPNAAEVMQGYAVAFRVGISISDLQLTVAIHPCSSE
EFVKLQITKRSGKDPRVQGCCG
Estimated Isoelectric Point:
8.46240997314453
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr29
Lys44
Gln17
Leu44
Gly52
Met7
Ser25
Tyr20
His6
Glu34
Arg19
Cys10
Phe14
Pro19
Val52
Asn16
Ala39
Ile26
Trp5
Asp24