Sequence:
download
CN38202sequence.fasta
>Cbn-ZYG-12 MLDLTNQESDASENGNSKYADSTDGRGVGTSRRIDIDEPSLEERRRDLDDLAVWMSGLEATDLPLDDPHSLCNGRAFAEL LHEIDKSFFDERWLETMPEMRTTSHLAVKRSNIRKLWRKMSDYIQNVMNRRICGARWEEIGDRVDGLDETDIPIAADIAM AVTFIALVGPNQEKYVHYSKIQTAKFAKEMTSVARLVGTVIEEMPDAIEPTFHEISELHDPQSDMRFSLPESSSINGNGL PERRRTSSNSDQVLAEAQLEIDALRAEKDSLQKEVDRLTKALESPPLDTSISSDTTNINILEKQNEELRVKRREAEERVL ELEAALEQFQSTVEKLTLENDTLTSTQKEFNLLKTHLDTAQSDVEEWRAKANQYQADAELVKKREKEVKELQGQVKSLTS RLEHHVKTATIDEDNKAGMIQLRTQIGTLTANNVELNVALESKKRIVEQLEIQLIQHKEKVKELEDRKDDLIAERNELEN KLLFKEQVTPRSLHESMFEAGNLSFDEKSKLPLEIENKRLAERIQELEALEPLKGEIITIKSQNGVLEEENLVVTKQKEE LERQVAELNDKLAKNQQHASGDVVELKVQLEKANVEIERMRESETKAETKLTDMEKLLELRTNERDNHEVLLAKSKRVID ELEERARPIGEDETTSVHVFKEMKEENERLRQKVEKLETELNSTTQELEQENRLITSAAHQQVLDRSSDNVMNMRAHAGS DEPQTLLDSQKMSGALQWSFIGLGFFLIFAYILIQIFSSINAPPTA
view sequence (766 aa)
>Cbn-ZYG-12
MLDLTNQESDASENGNSKYADSTDGRGVGTSRRIDIDEPSLEERRRDLDDLAVWMSGLEATDLPLDDPHSLCNGRAFAEL
LHEIDKSFFDERWLETMPEMRTTSHLAVKRSNIRKLWRKMSDYIQNVMNRRICGARWEEIGDRVDGLDETDIPIAADIAM
AVTFIALVGPNQEKYVHYSKIQTAKFAKEMTSVARLVGTVIEEMPDAIEPTFHEISELHDPQSDMRFSLPESSSINGNGL
PERRRTSSNSDQVLAEAQLEIDALRAEKDSLQKEVDRLTKALESPPLDTSISSDTTNINILEKQNEELRVKRREAEERVL
ELEAALEQFQSTVEKLTLENDTLTSTQKEFNLLKTHLDTAQSDVEEWRAKANQYQADAELVKKREKEVKELQGQVKSLTS
RLEHHVKTATIDEDNKAGMIQLRTQIGTLTANNVELNVALESKKRIVEQLEIQLIQHKEKVKELEDRKDDLIAERNELEN
KLLFKEQVTPRSLHESMFEAGNLSFDEKSKLPLEIENKRLAERIQELEALEPLKGEIITIKSQNGVLEEENLVVTKQKEE
LERQVAELNDKLAKNQQHASGDVVELKVQLEKANVEIERMRESETKAETKLTDMEKLLELRTNERDNHEVLLAKSKRVID
ELEERARPIGEDETTSVHVFKEMKEENERLRQKVEKLETELNSTTQELEQENRLITSAAHQQVLDRSSDNVMNMRAHAGS
DEPQTLLDSQKMSGALQWSFIGLGFFLIFAYILIQIFSSINAPPTA
Estimated Isoelectric Point:
4.89746856689453
Estimated Molecular Weight:
87.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr46
Lys54
Gln39
Leu87
Gly25
Met18
Ser53
Tyr6
His16
Glu103
Arg50
Cys2
Phe18
Pro20
Val41
Asn38
Ala53
Ile42
Trp6
Asp49