Sequence:
download
CN37966sequence.fasta
>Cbn-UNC-52 MKRSSTVVVALLALLLVTTDAARHRKYRQTYQDIDSDDETSDVQITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVRWA RVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTVEARATLNVVSYGPQEVSNGLRQSGQCMADEKACGNNECV KNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNSKSSDNGCKPTEFQCHD RRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTS EGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDEPRPSPPPTAPPQRATCDTRGAVSPYPNNYGSCDCKS QVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGYYRTKDRLMFAGDAEGVTISDIEERSIDRNAPFSFYKTG YLTFEGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSGSGQHSSDAMVVLKGNQNILVHRVRNQERVLRTDSPVRIT VETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTS CEDCAPGYERSGQGPYLGTCVPIQPRHQQCGPGALAPTAPAHGQCQCKTSVIGPNCDRCAPNSFGLAPTNPQGCIPCFCS GVSQQCSASNYKRKSVSIDYSRGDRDQLELTTSDSRSPFSPQTRAHVSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTA YGGVLKYTFKFSGSGSTDQSADVILRGNDIALQYKHREPFYPDRENNVEIKIFETSWQRVDGQQATREHLLMTLADLDTL LIKSTYNDDCTDSELISVNFEYAEPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQC DKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKK GYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGLQGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQ KPHEVLRVRIMEPKRQIAHPGDRVHWICQVTGFTNEKIHVEWTKVGEVSLPVNAKAYDGYLVLEGVEREQAGQYRCTATT ITQYATDDALLTISKKISGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHRDQLGGPLPHGVYQTGNALKIPQS QLHHAGRYICSAANQYGIGQSPPAVLEVKKPVTPPKVDPVRQTVDRDQPARFKCWVPGNSNVQLKWSRPGGGPLPSGVQE QQGILHIPRAGDQEVGQYVCTATDPRDNTPLQSEPVQLNIRDPAPQPRAAPQIDPPNQTVNVNDPAQFRCWVPGQPRAQL KWSRKDGRPLPNGILERDGFLRIDKSQLNDAGEYECTATEPDGSTQMSPPARLNVNQPQAIQPQVDPPVQTVNEGEPSRI RCWVPGHPNIHLQFVKRGRRPLPVHARVSGGNLEIPRTLKSDEDEYICIATDPNTNRPVESNPARVIVKSPIRPIIDPAE QTVPEGSPFRIRCYVPGHPSVQLSFRRVSGQLNEDADENNGLLAIQRAELSDEGDYICTARDPDTGAPIDSSPATVHVTS AAAPPVVEAHSPQHPVITPQTQTVPEGDPARIQCSVPGVPSAVQYLTFERADGRPLPFGSSDDRGVLTIPSTQIQDSGDY VCVYSPENQHPQKTGPSVLNVTPEGTPPRPVATPPLLSVAPGSPARFNCVAHSDTPARIKWGYKEENGPLPEHVNQDGDD IVISAAGDNNIGEYVCSATNDFGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKITWTGPDGS PLPHDVTPLEPNILDFSNGRSELNGEYTCTASNPIGEASDHGVVNIGPSLTVKTNPAGPKLIVTVGEPLQVKCEAFGAPG DPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHATATKNIYIEVVEPSRIATVSILGGS SQWFDQGEKGELICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNDEIIASAAVHVHS SADADDEPKVEIEPPRVRVVSQGDNIVLKCSVQDPKARVLWWHATEDLVSFTNVANTNHLHLKHADLCDRGFYYCTLEST NYEVGQSPNIVIVQQQGPLGAENGEHFKWALLRGGSLVRQLGTEPTLEISKADPSNDFGVYRCNVEDNNGLVIGSAYTAV SVGQQDKSHAQIVKFDDKSDASFTCPIYSVPGSKVEWTYDNGDLPPKAVPNGNKVEIKEFDDASAGTYVCRVSFDGNVVE GFVTAQMFVPDTIIQVLLEVSSESPQIGDRAWFDCKVTGDPSAVISWTKEGNDDLPPNAQVTGGRLLFTDLKEDNAGVYR CVAKTKAGPLQTRTVLNVGSGKRKRKHLGNRRGRLLEHVLDFLDKSYLRYTCEIVKEVDPVFSTIDLQIDDFVPVINGDA IELPPLTDEEIVNFDIEITLNSSETKGVIFETKRINSGDLLAQPYDTIHHEARITDHGTILYEFDVGNGRQIVETTTPIT PNEWNVIKIKNDKNQVTIQLNDDSATVRQHSNPLPSLSLGVNRPVFIGGRHEPMSEADDFNGIISQVILSGQNVGLGEAR IPPSVVKYDACASTSLCLNGAKCRNSNNHHGFSCECSSKFHGEYCQWRSNTCHEETCNTGICLDNEESWQCVCPLGTTGL RCEEKAEIPQPLGFTSDTSFIAVRKPVKFESIKMKLRPEKDNDEHILMYFASGYGATAKQYASLSLIDHQVVLTVNKPNH ETQQIRSETLVSGELIDVGVKQTGNALVMTVNGNQVSTIETESLKPGTEIFIGGLPPGLNSPDDVVEQSFRGCVYEIFIN SEDVDLMNLTSSGDISSCEESQISVEDITTEEPTIEEPTTQEPFTTTVEPDTTTSEELVTTTESTTTSTEIPTTAPTTEP VTTTEEVYHIYETSRDDDPEILIPVETTTTTEEPETALILPTDPVEDNDVSDEEEEIAHVSTVSPDADTDSDYNEGTLSP DSEEMFNPDEKCICSLPSTEDPDKNTICENSTCGVNGHCVPRNKTHYTCECKLYYDGPVCSLFKPIEHAARFDGDAFIEL SSDEFPHLTSEKDEIVAFKFKTQLPNGVLLWQGQRPTVTQMEDYISVGIVNGHLHFSYELGGGAAHLVSEERVDDGKEHS VRFERKGREGLMKIDNHREVNGRSTGILAMLNVDGNIFVGGVPDIARATGGLFAHNFVGCIADVELNGVRLDLMATAIDG KNVKPCDEWIHRKRWLYRRRVR
view sequence (3382 aa)
>Cbn-UNC-52
MKRSSTVVVALLALLLVTTDAARHRKYRQTYQDIDSDDETSDVQITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVRWA
RVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTVEARATLNVVSYGPQEVSNGLRQSGQCMADEKACGNNECV
KNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNSKSSDNGCKPTEFQCHD
RRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTS
EGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDEPRPSPPPTAPPQRATCDTRGAVSPYPNNYGSCDCKS
QVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGYYRTKDRLMFAGDAEGVTISDIEERSIDRNAPFSFYKTG
YLTFEGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSGSGQHSSDAMVVLKGNQNILVHRVRNQERVLRTDSPVRIT
VETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTS
CEDCAPGYERSGQGPYLGTCVPIQPRHQQCGPGALAPTAPAHGQCQCKTSVIGPNCDRCAPNSFGLAPTNPQGCIPCFCS
GVSQQCSASNYKRKSVSIDYSRGDRDQLELTTSDSRSPFSPQTRAHVSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTA
YGGVLKYTFKFSGSGSTDQSADVILRGNDIALQYKHREPFYPDRENNVEIKIFETSWQRVDGQQATREHLLMTLADLDTL
LIKSTYNDDCTDSELISVNFEYAEPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQC
DKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKK
GYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGLQGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQ
KPHEVLRVRIMEPKRQIAHPGDRVHWICQVTGFTNEKIHVEWTKVGEVSLPVNAKAYDGYLVLEGVEREQAGQYRCTATT
ITQYATDDALLTISKKISGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHRDQLGGPLPHGVYQTGNALKIPQS
QLHHAGRYICSAANQYGIGQSPPAVLEVKKPVTPPKVDPVRQTVDRDQPARFKCWVPGNSNVQLKWSRPGGGPLPSGVQE
QQGILHIPRAGDQEVGQYVCTATDPRDNTPLQSEPVQLNIRDPAPQPRAAPQIDPPNQTVNVNDPAQFRCWVPGQPRAQL
KWSRKDGRPLPNGILERDGFLRIDKSQLNDAGEYECTATEPDGSTQMSPPARLNVNQPQAIQPQVDPPVQTVNEGEPSRI
RCWVPGHPNIHLQFVKRGRRPLPVHARVSGGNLEIPRTLKSDEDEYICIATDPNTNRPVESNPARVIVKSPIRPIIDPAE
QTVPEGSPFRIRCYVPGHPSVQLSFRRVSGQLNEDADENNGLLAIQRAELSDEGDYICTARDPDTGAPIDSSPATVHVTS
AAAPPVVEAHSPQHPVITPQTQTVPEGDPARIQCSVPGVPSAVQYLTFERADGRPLPFGSSDDRGVLTIPSTQIQDSGDY
VCVYSPENQHPQKTGPSVLNVTPEGTPPRPVATPPLLSVAPGSPARFNCVAHSDTPARIKWGYKEENGPLPEHVNQDGDD
IVISAAGDNNIGEYVCSATNDFGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKITWTGPDGS
PLPHDVTPLEPNILDFSNGRSELNGEYTCTASNPIGEASDHGVVNIGPSLTVKTNPAGPKLIVTVGEPLQVKCEAFGAPG
DPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHATATKNIYIEVVEPSRIATVSILGGS
SQWFDQGEKGELICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNDEIIASAAVHVHS
SADADDEPKVEIEPPRVRVVSQGDNIVLKCSVQDPKARVLWWHATEDLVSFTNVANTNHLHLKHADLCDRGFYYCTLEST
NYEVGQSPNIVIVQQQGPLGAENGEHFKWALLRGGSLVRQLGTEPTLEISKADPSNDFGVYRCNVEDNNGLVIGSAYTAV
SVGQQDKSHAQIVKFDDKSDASFTCPIYSVPGSKVEWTYDNGDLPPKAVPNGNKVEIKEFDDASAGTYVCRVSFDGNVVE
GFVTAQMFVPDTIIQVLLEVSSESPQIGDRAWFDCKVTGDPSAVISWTKEGNDDLPPNAQVTGGRLLFTDLKEDNAGVYR
CVAKTKAGPLQTRTVLNVGSGKRKRKHLGNRRGRLLEHVLDFLDKSYLRYTCEIVKEVDPVFSTIDLQIDDFVPVINGDA
IELPPLTDEEIVNFDIEITLNSSETKGVIFETKRINSGDLLAQPYDTIHHEARITDHGTILYEFDVGNGRQIVETTTPIT
PNEWNVIKIKNDKNQVTIQLNDDSATVRQHSNPLPSLSLGVNRPVFIGGRHEPMSEADDFNGIISQVILSGQNVGLGEAR
IPPSVVKYDACASTSLCLNGAKCRNSNNHHGFSCECSSKFHGEYCQWRSNTCHEETCNTGICLDNEESWQCVCPLGTTGL
RCEEKAEIPQPLGFTSDTSFIAVRKPVKFESIKMKLRPEKDNDEHILMYFASGYGATAKQYASLSLIDHQVVLTVNKPNH
ETQQIRSETLVSGELIDVGVKQTGNALVMTVNGNQVSTIETESLKPGTEIFIGGLPPGLNSPDDVVEQSFRGCVYEIFIN
SEDVDLMNLTSSGDISSCEESQISVEDITTEEPTIEEPTTQEPFTTTVEPDTTTSEELVTTTESTTTSTEIPTTAPTTEP
VTTTEEVYHIYETSRDDDPEILIPVETTTTTEEPETALILPTDPVEDNDVSDEEEEIAHVSTVSPDADTDSDYNEGTLSP
DSEEMFNPDEKCICSLPSTEDPDKNTICENSTCGVNGHCVPRNKTHYTCECKLYYDGPVCSLFKPIEHAARFDGDAFIEL
SSDEFPHLTSEKDEIVAFKFKTQLPNGVLLWQGQRPTVTQMEDYISVGIVNGHLHFSYELGGGAAHLVSEERVDDGKEHS
VRFERKGREGLMKIDNHREVNGRSTGILAMLNVDGNIFVGGVPDIARATGGLFAHNFVGCIADVELNGVRLDLMATAIDG
KNVKPCDEWIHRKRWLYRRRVR
Estimated Isoelectric Point:
4.91156768798828
Estimated Molecular Weight:
370.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr240
Lys128
Gln151
Leu207
Gly269
Met21
Ser229
Tyr95
His85
Glu239
Arg177
Cys134
Phe93
Pro263
Val264
Asn164
Ala193
Ile161
Trp35
Asp234