Sequence:
download
CN37835sequence.fasta
>Cbn-NRX-1 MRRTFDDTGQYSKWFTIVILIFTQLNAVDSIILTGAPDSYARYPKWAHSFENSLSMELKTRQSDGMLLYTDDGGTHGNFY SLTIVEGHIQLDFRLGDNSNEFGQRRPVNTIRIEEVRIDDDKWHTLTIFQSWENVKLELDYTLVFKILNQRSFVFGNILK NSDVFIGGLPPNMHMLPVMSSPLRRYSRHLAVNVRNLMYRQYPQGVTSPQLLESVGTRTNEDDHCKSKSVCMSSREQFVC LNDGECYSANDGPHCDCQFSDHDGRNCEIGKRFNYFPDLFFDGRSGRRLWENVIFISEKSDGELTFGGDEWVGYDVSMNI SAAVRAKKENLTLTFKTVHGTSMLFYAGDEKSFLHVMLQDGAIIASSKFDGSDARIIRMFNSFPSQRYDDDSWHTIILER SLQMMTLIVDGRRDEIRQYAPELDWISNSFAYLGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRVLLVNLADQSYGGSV VKTGGDLSYSCKNPSQRSDVLSFTDTSSFLTLPRWNSLSSGSLSFHFRTTSPDGLILYHGVLQHNATDYVAFELIDSHLF MIINLGSGVVRLQTTAMKVSDGEWHHVQLDRLSRTGSVIVDAIKIDFSTPGVSANLIIDDPIFIGNVPNNSIAYPPSVWS ITLQKGYTGCIKNIRLNGVSAKIAQQFETSNSTGIELGCALSNELDICEPNPCQNFGRCTRNLNSFECDCSNTNFEGKRC EIEQTAVEVDGEESKVHVLAHTKVSQVEHIQIRFRTASTRGVLFDTGANGKNDKITVFLNDSLLNLFLQDSSTNNTFSWG KSLSDNHWHELQVRRLGQKLLLYLDGFWSHSIYLQNPISVEIDEVGAAYSVHPSSPPPRDEHFKGFLSKLVFNGNDYLAK TKRNSAQLSKSSSRESKGQRNVKTRIASISFTNSTGYVAFTSEKISSLSGSFRVQFKFQTLMRSALLFFTLPKHDYDQSF RLQITNGRLKYTYRISGQEFHTTSPKLPYRQHLSDMRWHNVLIYQDEKTNDHLLLIDNSTTTLIIDKMKKVESKMSGKLY FGSNPLGVSRPSNGYRGCISSLRINENALNLYEDADSRMNVNRGCSVFISSSFFLLLNKTLLISGPIARCVEDACANHGR CIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFDGSPSAIFYEYAPNERPTSSKDYFVFSFRTTQPNGVVIAIECAADQDYF TIFLSKGYLNAHYNLGSRDHTVSYHTRVLNDGFPHVIKISRNEANMTIQVDNLPALRYRPRKASDLVLLNMQTRISIGAS FNTRHSVPGEMRHRRNTEIFDSYQGEVSGVNVNGLMILDLYENGESFPHNFPFCIFYINLL
view sequence (1341 aa)
>Cbn-NRX-1
MRRTFDDTGQYSKWFTIVILIFTQLNAVDSIILTGAPDSYARYPKWAHSFENSLSMELKTRQSDGMLLYTDDGGTHGNFY
SLTIVEGHIQLDFRLGDNSNEFGQRRPVNTIRIEEVRIDDDKWHTLTIFQSWENVKLELDYTLVFKILNQRSFVFGNILK
NSDVFIGGLPPNMHMLPVMSSPLRRYSRHLAVNVRNLMYRQYPQGVTSPQLLESVGTRTNEDDHCKSKSVCMSSREQFVC
LNDGECYSANDGPHCDCQFSDHDGRNCEIGKRFNYFPDLFFDGRSGRRLWENVIFISEKSDGELTFGGDEWVGYDVSMNI
SAAVRAKKENLTLTFKTVHGTSMLFYAGDEKSFLHVMLQDGAIIASSKFDGSDARIIRMFNSFPSQRYDDDSWHTIILER
SLQMMTLIVDGRRDEIRQYAPELDWISNSFAYLGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRVLLVNLADQSYGGSV
VKTGGDLSYSCKNPSQRSDVLSFTDTSSFLTLPRWNSLSSGSLSFHFRTTSPDGLILYHGVLQHNATDYVAFELIDSHLF
MIINLGSGVVRLQTTAMKVSDGEWHHVQLDRLSRTGSVIVDAIKIDFSTPGVSANLIIDDPIFIGNVPNNSIAYPPSVWS
ITLQKGYTGCIKNIRLNGVSAKIAQQFETSNSTGIELGCALSNELDICEPNPCQNFGRCTRNLNSFECDCSNTNFEGKRC
EIEQTAVEVDGEESKVHVLAHTKVSQVEHIQIRFRTASTRGVLFDTGANGKNDKITVFLNDSLLNLFLQDSSTNNTFSWG
KSLSDNHWHELQVRRLGQKLLLYLDGFWSHSIYLQNPISVEIDEVGAAYSVHPSSPPPRDEHFKGFLSKLVFNGNDYLAK
TKRNSAQLSKSSSRESKGQRNVKTRIASISFTNSTGYVAFTSEKISSLSGSFRVQFKFQTLMRSALLFFTLPKHDYDQSF
RLQITNGRLKYTYRISGQEFHTTSPKLPYRQHLSDMRWHNVLIYQDEKTNDHLLLIDNSTTTLIIDKMKKVESKMSGKLY
FGSNPLGVSRPSNGYRGCISSLRINENALNLYEDADSRMNVNRGCSVFISSSFFLLLNKTLLISGPIARCVEDACANHGR
CIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFDGSPSAIFYEYAPNERPTSSKDYFVFSFRTTQPNGVVIAIECAADQDYF
TIFLSKGYLNAHYNLGSRDHTVSYHTRVLNDGFPHVIKISRNEANMTIQVDNLPALRYRPRKASDLVLLNMQTRISIGAS
FNTRHSVPGEMRHRRNTEIFDSYQGEVSGVNVNGLMILDLYENGESFPHNFPFCIFYINLL
Estimated Isoelectric Point:
7.10868072509766
Estimated Molecular Weight:
151.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr78
Lys57
Gln48
Leu121
Gly86
Met26
Ser143
Tyr47
His41
Glu58
Arg84
Cys27
Phe76
Pro47
Val78
Asn87
Ala53
Ile83
Trp16
Asp85