Sequence:
download
CN33554sequence.fasta
>Cbn-UNC-2 MISSDTLLNVFLAIAVDNLANAQELTAAEEADEKANEIEEESEEVDEQYQEGDHCTIDMEGKTAGDLCAVARAMDEMDEE CEEEESPFGGPKPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCF TGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPK LKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRP FNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEA ELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRL FNTALTAVFTVESILKILAFGVRVSFLTMLTVFILNFHFQNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLF RAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFR CATGEGWQDIMMAAVQGKDCARAGSTEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGP HHLDEFIRVWADYDPAATGRIHYTEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLS IKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYRARKSGTEVGGQGLFGG GLRSLVAAAKAAESQHSSHTPQPPEETTPIISHPQQYATAPTMSVQGSSQQGQGTSSGGGQVMLQMELDKEPGIIQRPYS LFNSFVDTIKSGKADGDITPVQYQSVDPQHDKMNSTGRRLSDMFSKIRRGTSADHNPHQTEHLLAQDNRSPSSPRYRSMA RASPPSPAERYANPPRYRTESPPSSRSEYQMSIRDPIIRRNRYNTMEHSRSSHEPHYHHHPEHQPLHHQHQHQLQHQQHP SHSQHLQHTHHKMYQNHNQYSRSPIYSDDSSVAESYRREREFRRYQDSTPQDVSEDDDPMPTAVRSRRLPLISTMPTHYE SAFQPSYNQHLNDSYGIIVFHSLDLIKVLGLGTGYQRDYHTSHPHSHHSTSQHQPMYSTSPLISPRSSHSYYTPRSSQYY EIPSPSPDIYPSYRASASPRRYPTSTVVVAPDREGSSARVIQAQPGSIPLSDSETEDDPRWAIV
view sequence (1344 aa)
>Cbn-UNC-2
MISSDTLLNVFLAIAVDNLANAQELTAAEEADEKANEIEEESEEVDEQYQEGDHCTIDMEGKTAGDLCAVARAMDEMDEE
CEEEESPFGGPKPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCF
TGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPK
LKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRP
FNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEA
ELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRL
FNTALTAVFTVESILKILAFGVRVSFLTMLTVFILNFHFQNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLF
RAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFR
CATGEGWQDIMMAAVQGKDCARAGSTEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGP
HHLDEFIRVWADYDPAATGRIHYTEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLS
IKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYRARKSGTEVGGQGLFGG
GLRSLVAAAKAAESQHSSHTPQPPEETTPIISHPQQYATAPTMSVQGSSQQGQGTSSGGGQVMLQMELDKEPGIIQRPYS
LFNSFVDTIKSGKADGDITPVQYQSVDPQHDKMNSTGRRLSDMFSKIRRGTSADHNPHQTEHLLAQDNRSPSSPRYRSMA
RASPPSPAERYANPPRYRTESPPSSRSEYQMSIRDPIIRRNRYNTMEHSRSSHEPHYHHHPEHQPLHHQHQHQLQHQQHP
SHSQHLQHTHHKMYQNHNQYSRSPIYSDDSSVAESYRREREFRRYQDSTPQDVSEDDDPMPTAVRSRRLPLISTMPTHYE
SAFQPSYNQHLNDSYGIIVFHSLDLIKVLGLGTGYQRDYHTSHPHSHHSTSQHQPMYSTSPLISPRSSHSYYTPRSSQYY
EIPSPSPDIYPSYRASASPRRYPTSTVVVAPDREGSSARVIQAQPGSIPLSDSETEDDPRWAIV
Estimated Isoelectric Point:
6.17087554931641
Estimated Molecular Weight:
153.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr76
Lys45
Gln65
Leu109
Gly68
Met46
Ser109
Tyr56
His49
Glu79
Arg79
Cys21
Phe86
Pro81
Val81
Asn58
Ala81
Ile78
Trp11
Asp66