Sequence:
download
CN33149sequence.fasta
>Cbn-UNC-22 MVGAPRFTQKPSIQQTPTVSLFLGDLLMECHLEADPQPTIAWQHSGNLLEPSGRVVQTLSPLGGSLYKATLVIKEPNAGD GGAYKCTAKNQLGESNANINLNFAGAGGDEAKSRGPSFVGKPRIIPKDGGALIVMECKVKSASTPVAKWMKDGVPLNMGG LYHAIFSDLGDQTFLCQLEIRVSSFEVIVFLKSERIQGPSSSDAGQYRCNIRNDQGETNANLALNFEEPDPSERQERKRS TASPRPSSRGPGSRPSSPKKSMKSREGTPKRTLKPREGSPSKKLRKKLVFSIESLFSVSIQLFLLIQKLIRSRTSTPVNE EMSQSESRRSSRTDKMEVDQVSSGASKRKPDGLPPPGGDEKKLRAGSPSARKSPSRKSASPTPSRKASGAGGAGGASGAT GASGSSTTTATSGGSSSSTTTTTATSAASSQQIHDPSRDKYTRPPIVLEASRSQTGRVGGSVVLEVEWKCHSSTIIEWYR DGTLVRNSSEYVQTFNGSIAKLQVNNLTEEKSGLYKCHAKCEYGDGQSSAMVKVEQSDVEEELMKHRKDLEDEYQKEEDR RASQSLQAETKKRVARRSKSKSKSPVSISQRNVKDRSNSRHHKQRRAQHLIAFVPMLQNQNRREVQVFDRIQMSNDGSDH SNGASPSSSSSFSRRLPPRPPFESSHSTASNPSSSSNAPRRMINLRSVSDRQGAARTKGDSPNPLNMRSANSSGPDLHKI SQIHAFILSKMPEGEAKDRFLKSILDLEGPDSRRGSRDDVGSPKLKKTNSKSSVNSSSNDTVESQLDEIPSSGLTIPEER RRELLGQVGESDDEVSESISELPSFAGGKPRRKTDSPPKQDEMFSRDTVLRKTTTTRNESSTVEEQTKLRKTVKKADGEL DFKAMVKLKKVKKEEGGTAEKPGFPLDHADSTSSVLSQESRSRRGSTALFGKEGLPEQAGNPFAQLKKVKSGAGGLEKSD SMASVQKLELKKGKVEENSDGAFKVQLKKVVKKEVKESTVSLKEKNGTESGIKTEFKMEKRERTTLQKYEKTDSNGSKKE EKPKKVSIAPVPTSTSSDGEPTTPRHHEKVEEKSKSEELKTKVGGRQVGQKRNGAAPKPEEPKNLLSQIQLKKVTKKAQE ETNELEGIKLKKVTTVPKHVADDDSQSESESRRGSVFGEFRRGSRAPRDSADNSRRDSIRRSSIDMRRESVQEILEKFQT STPLVPSGASGSAPKIVEVPENVTVENKKKFENEFSDETAILTCKVTGSPAPTFKWFKGSREVISGGRFKHITDGKEQTV ALAMLKCRSQDEGPYTLTIENAHGTDSADVKLLVTSDNGLDFRAMLKHRESQVGFQKDGEGGAGGAGGGDKKPMTEAERR QSLFPGKKVEKWDVPLPDKTVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVIEKNVCTLIINNPEVDDTG KYTCEANGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWWRGNKQIQEGDPRFIIEKDAVGR CTLTIKEVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESELATLETDVNDKDAEVVWWHDGKRIDIDG VKFQVESSNRKRRLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDDVTLMCQTKDTKTPGIWFR NGKQISSMPGGKFETQSRNGTHTLKIGKIEMNEADVYEIDQAGLRGSCNVTVLEAEKRPVINWKPKKIEAKAGEPCVVKV PFQIKGTRRGDPKAQILKNGKPIDEEMRKLVEVVIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELFVKDKPKP PKGPLETKNVTAEGLDLVWGTPEPDEGAPVKAYIIEMQEGRSGNWVKVGETKGTDFKVKDLKEHGEYKFRVKAQNECGLS DPLTGESVLAKNPYGTPGKPKNMEAIDIDKDHCTLAWEPPEEDGGTPITGYIIERREKSEKDWHQVGQTKPDCCELTDKK VVEDKEYLYRVKAVNKAGPGDPCDHGKPIKIKAKKASPEFTGGGIKDLRLKVGETIKYEVPISGEPLPDCTWIVNGKPLK AVGRVKMASERGKHVMKIENAVRGDSGQYTITLKNSSGTCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPEDDG GDPLTGYIVEAQDMDNKGKYIEVGRVDPNTNTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTLIKDPWDEPGKPGR PEITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASITGLKEGKEYQFRVKAVNKAGPGQPSE PSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEHTILCIPSAMR SDVGEYRLTVKNSHGADEEKANLTVLDRPGKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCA KVKDTKAHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPKSDGGAPI TQYIIEKKGKHGRDWQECGKVSGDQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWIDREAMKTV TIKVGNDVEFDVPVRGEPPPKKEWLFIDKTIDDQKIRVSFFSIENEDYKTRFVLRGATRKHAGLYTLTATNASGSDKHSV EVIVLGKPSSPLGPLEVSNVYEDRCDLEWQVPEDDGGAPIDHYEIEKMDMATGRWVPCGRSETTKTTVPNLQPGHEYKFR VRAVNKEGESDPLTTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNKPDDGGAPIEAYVIEKKDKNGRWEEALVVPG DQNTATVPNLKEGEEYQFRISARNKAGTGDPSDPSDRVIAKPRNLAPHIHREDLSDTTVKVGASLKFVVHIDGEPAPDVT WSFNGKGIGESKAQIENEPYISRFALPKALRKQSGKYTITATNVNGTDSVTIDIKVKSKPTKPKGPIEVTDVFEDRATLD WKPPEDDGGEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDTLNKGDHYKFRVKAVNSEGASEPLETETDILAKNPFDRP DRPGRPEPTDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGSQETVSCFPLFPSLINTFFSVKPHIDRDALKNLRIKA GQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQTKLVVRQMERGDSGTYVIKAVNVNGEDEATVKINVIDK PTPPNGPLDVLDVHGDHVTLDWRAPDDDGGIPIDNYVIEKYDTANGRWVPAAKVAGDKTTAVVDGLIPGHEYKFRVAAVN AEGESEPLETFGTTLAKDPFDKPGKTGAPDVTDWDKDHVDLEWKPPANDGGAPIEEYVVEMKDEFSPFWNEVAHVPAGQT NATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTFE GTPVESDDRMKLANEDGKTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVTVLDHPSSPRGPLDITNIVKDGCDLAWKE PEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLVQGHEYKFRVKAVNRHGDSDPLEAREAIIAKDPFDRADKP GTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVKVGAGELTATVDGLKPGQTYQFRVKALNKAGEST PSDPSRTMIAKPRHLAPKINRDMFIAQRIKAGQTLNFDVNVEGEPAPKIEWFLNGSPLPSGGKTHIDNNTDNNTKLTTKD TARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWDEPLDDGGSPITNYIVEKQEDGGRWVP CGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGGA PIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETYQFRVKAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLLD LRIKAGTPIKLDITFEGEPAPVATWKANDKTVETGARADVTNTPTSSAIHIFSAVRGDTGVYKIIVENEHGKDTAQCNVT VLDVPGTPEGPLKIDEIHKEGCTLNWKPPVDNGGTDILHYIVEKMDTSRGTWQEVGTFPDCNAKVTKLVPGKEYSFRVKA VNLQGESKPLEAEEPIIAKNQFEVPDPVDKPEVTDWDKDRIDIKWNPTANNGGAPVTGYIVEKKEKGSSIWNEAGKTAGT TFSADNLKPGVEYEFRVIAVNAAGPSDPSEPTDPQITKARYLKPKILTANRKIKIKAGFTHNLEVDFVGAPDPTATWTVG DSGAALAPELIVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEGIFEVIVQDRPAAPEGPLEVSDVTKDSCVLNWKP PKDDGGAEISNYVVEKRDTRTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMAENAFGRSDSLNTDEPVLAKDPFGTPGK PGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDVERKDAKTGRWIKVNTSPVQGTAFSDTRVQKGHTYEYRVVAVNKAGP GQPSDPSASATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISWTKEGGKPLAGVETTDSQTKLVIPSTR RTDSGPVKIKAVNPYGEAEANIKITVIDKPSPPENITYPAVSRHTCTLNWDAPKDDGGSEIAGYRIEYQEIGSQIWDKVP GLISGTNYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPI LGYVVERFEKRGGGDWAPVKMPMVKGTECIVPGLHENETYQFRVRAVNAAGQGEPSNGSEPVTCRPYVEKPGAPDAPRVG KITKNSAELTWNRPLRDGGAPIDGYIIEKKKLGDNDWTRCNDKPVRETAFEVKNLGEKEEYEFRVIAVNSAGEGEPSKPS DLVLIEEQPGRPIFDITNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNGNSPIFENERTVVDVNPGEIVITTTGSKRSD AGPYKISATNKYGKDTCKLNEYLPEMEPEDSTGFWNKVYSPLHASTVAKELTLLAPMDKPVKKPKMSINELNQKDALSFD NYLKKLQEKNEVA
view sequence (5213 aa)
>Cbn-UNC-22
MVGAPRFTQKPSIQQTPTVSLFLGDLLMECHLEADPQPTIAWQHSGNLLEPSGRVVQTLSPLGGSLYKATLVIKEPNAGD
GGAYKCTAKNQLGESNANINLNFAGAGGDEAKSRGPSFVGKPRIIPKDGGALIVMECKVKSASTPVAKWMKDGVPLNMGG
LYHAIFSDLGDQTFLCQLEIRVSSFEVIVFLKSERIQGPSSSDAGQYRCNIRNDQGETNANLALNFEEPDPSERQERKRS
TASPRPSSRGPGSRPSSPKKSMKSREGTPKRTLKPREGSPSKKLRKKLVFSIESLFSVSIQLFLLIQKLIRSRTSTPVNE
EMSQSESRRSSRTDKMEVDQVSSGASKRKPDGLPPPGGDEKKLRAGSPSARKSPSRKSASPTPSRKASGAGGAGGASGAT
GASGSSTTTATSGGSSSSTTTTTATSAASSQQIHDPSRDKYTRPPIVLEASRSQTGRVGGSVVLEVEWKCHSSTIIEWYR
DGTLVRNSSEYVQTFNGSIAKLQVNNLTEEKSGLYKCHAKCEYGDGQSSAMVKVEQSDVEEELMKHRKDLEDEYQKEEDR
RASQSLQAETKKRVARRSKSKSKSPVSISQRNVKDRSNSRHHKQRRAQHLIAFVPMLQNQNRREVQVFDRIQMSNDGSDH
SNGASPSSSSSFSRRLPPRPPFESSHSTASNPSSSSNAPRRMINLRSVSDRQGAARTKGDSPNPLNMRSANSSGPDLHKI
SQIHAFILSKMPEGEAKDRFLKSILDLEGPDSRRGSRDDVGSPKLKKTNSKSSVNSSSNDTVESQLDEIPSSGLTIPEER
RRELLGQVGESDDEVSESISELPSFAGGKPRRKTDSPPKQDEMFSRDTVLRKTTTTRNESSTVEEQTKLRKTVKKADGEL
DFKAMVKLKKVKKEEGGTAEKPGFPLDHADSTSSVLSQESRSRRGSTALFGKEGLPEQAGNPFAQLKKVKSGAGGLEKSD
SMASVQKLELKKGKVEENSDGAFKVQLKKVVKKEVKESTVSLKEKNGTESGIKTEFKMEKRERTTLQKYEKTDSNGSKKE
EKPKKVSIAPVPTSTSSDGEPTTPRHHEKVEEKSKSEELKTKVGGRQVGQKRNGAAPKPEEPKNLLSQIQLKKVTKKAQE
ETNELEGIKLKKVTTVPKHVADDDSQSESESRRGSVFGEFRRGSRAPRDSADNSRRDSIRRSSIDMRRESVQEILEKFQT
STPLVPSGASGSAPKIVEVPENVTVENKKKFENEFSDETAILTCKVTGSPAPTFKWFKGSREVISGGRFKHITDGKEQTV
ALAMLKCRSQDEGPYTLTIENAHGTDSADVKLLVTSDNGLDFRAMLKHRESQVGFQKDGEGGAGGAGGGDKKPMTEAERR
QSLFPGKKVEKWDVPLPDKTVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVIEKNVCTLIINNPEVDDTG
KYTCEANGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWWRGNKQIQEGDPRFIIEKDAVGR
CTLTIKEVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESELATLETDVNDKDAEVVWWHDGKRIDIDG
VKFQVESSNRKRRLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDDVTLMCQTKDTKTPGIWFR
NGKQISSMPGGKFETQSRNGTHTLKIGKIEMNEADVYEIDQAGLRGSCNVTVLEAEKRPVINWKPKKIEAKAGEPCVVKV
PFQIKGTRRGDPKAQILKNGKPIDEEMRKLVEVVIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELFVKDKPKP
PKGPLETKNVTAEGLDLVWGTPEPDEGAPVKAYIIEMQEGRSGNWVKVGETKGTDFKVKDLKEHGEYKFRVKAQNECGLS
DPLTGESVLAKNPYGTPGKPKNMEAIDIDKDHCTLAWEPPEEDGGTPITGYIIERREKSEKDWHQVGQTKPDCCELTDKK
VVEDKEYLYRVKAVNKAGPGDPCDHGKPIKIKAKKASPEFTGGGIKDLRLKVGETIKYEVPISGEPLPDCTWIVNGKPLK
AVGRVKMASERGKHVMKIENAVRGDSGQYTITLKNSSGTCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPEDDG
GDPLTGYIVEAQDMDNKGKYIEVGRVDPNTNTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTLIKDPWDEPGKPGR
PEITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASITGLKEGKEYQFRVKAVNKAGPGQPSE
PSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEHTILCIPSAMR
SDVGEYRLTVKNSHGADEEKANLTVLDRPGKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCA
KVKDTKAHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPKSDGGAPI
TQYIIEKKGKHGRDWQECGKVSGDQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWIDREAMKTV
TIKVGNDVEFDVPVRGEPPPKKEWLFIDKTIDDQKIRVSFFSIENEDYKTRFVLRGATRKHAGLYTLTATNASGSDKHSV
EVIVLGKPSSPLGPLEVSNVYEDRCDLEWQVPEDDGGAPIDHYEIEKMDMATGRWVPCGRSETTKTTVPNLQPGHEYKFR
VRAVNKEGESDPLTTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNKPDDGGAPIEAYVIEKKDKNGRWEEALVVPG
DQNTATVPNLKEGEEYQFRISARNKAGTGDPSDPSDRVIAKPRNLAPHIHREDLSDTTVKVGASLKFVVHIDGEPAPDVT
WSFNGKGIGESKAQIENEPYISRFALPKALRKQSGKYTITATNVNGTDSVTIDIKVKSKPTKPKGPIEVTDVFEDRATLD
WKPPEDDGGEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDTLNKGDHYKFRVKAVNSEGASEPLETETDILAKNPFDRP
DRPGRPEPTDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGSQETVSCFPLFPSLINTFFSVKPHIDRDALKNLRIKA
GQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQTKLVVRQMERGDSGTYVIKAVNVNGEDEATVKINVIDK
PTPPNGPLDVLDVHGDHVTLDWRAPDDDGGIPIDNYVIEKYDTANGRWVPAAKVAGDKTTAVVDGLIPGHEYKFRVAAVN
AEGESEPLETFGTTLAKDPFDKPGKTGAPDVTDWDKDHVDLEWKPPANDGGAPIEEYVVEMKDEFSPFWNEVAHVPAGQT
NATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTFE
GTPVESDDRMKLANEDGKTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVTVLDHPSSPRGPLDITNIVKDGCDLAWKE
PEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLVQGHEYKFRVKAVNRHGDSDPLEAREAIIAKDPFDRADKP
GTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVKVGAGELTATVDGLKPGQTYQFRVKALNKAGEST
PSDPSRTMIAKPRHLAPKINRDMFIAQRIKAGQTLNFDVNVEGEPAPKIEWFLNGSPLPSGGKTHIDNNTDNNTKLTTKD
TARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWDEPLDDGGSPITNYIVEKQEDGGRWVP
CGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGGA
PIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETYQFRVKAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLLD
LRIKAGTPIKLDITFEGEPAPVATWKANDKTVETGARADVTNTPTSSAIHIFSAVRGDTGVYKIIVENEHGKDTAQCNVT
VLDVPGTPEGPLKIDEIHKEGCTLNWKPPVDNGGTDILHYIVEKMDTSRGTWQEVGTFPDCNAKVTKLVPGKEYSFRVKA
VNLQGESKPLEAEEPIIAKNQFEVPDPVDKPEVTDWDKDRIDIKWNPTANNGGAPVTGYIVEKKEKGSSIWNEAGKTAGT
TFSADNLKPGVEYEFRVIAVNAAGPSDPSEPTDPQITKARYLKPKILTANRKIKIKAGFTHNLEVDFVGAPDPTATWTVG
DSGAALAPELIVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEGIFEVIVQDRPAAPEGPLEVSDVTKDSCVLNWKP
PKDDGGAEISNYVVEKRDTRTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMAENAFGRSDSLNTDEPVLAKDPFGTPGK
PGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDVERKDAKTGRWIKVNTSPVQGTAFSDTRVQKGHTYEYRVVAVNKAGP
GQPSDPSASATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISWTKEGGKPLAGVETTDSQTKLVIPSTR
RTDSGPVKIKAVNPYGEAEANIKITVIDKPSPPENITYPAVSRHTCTLNWDAPKDDGGSEIAGYRIEYQEIGSQIWDKVP
GLISGTNYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPI
LGYVVERFEKRGGGDWAPVKMPMVKGTECIVPGLHENETYQFRVRAVNAAGQGEPSNGSEPVTCRPYVEKPGAPDAPRVG
KITKNSAELTWNRPLRDGGAPIDGYIIEKKKLGDNDWTRCNDKPVRETAFEVKNLGEKEEYEFRVIAVNSAGEGEPSKPS
DLVLIEEQPGRPIFDITNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNGNSPIFENERTVVDVNPGEIVITTTGSKRSD
AGPYKISATNKYGKDTCKLNEYLPEMEPEDSTGFWNKVYSPLHASTVAKELTLLAPMDKPVKKPKMSINELNQKDALSFD
NYLKKLQEKNEVA
Estimated Isoelectric Point:
6.10048675537109
Estimated Molecular Weight:
573.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr350
Lys492
Gln146
Leu281
Gly423
Met55
Ser352
Tyr104
His83
Glu414
Arg261
Cys49
Phe133
Pro388
Val385
Asn229
Ala339
Ile259
Trp83
Asp387