Sequence:
download
CN30046sequence.fasta
>Cbn-EGL-8 MAKEFQFNWKPNIPTPLLQGACFDRYDDESTCLELNAQVRIDEYGFFFNWLVEGKDAVVLDMGQIWEARPGGLPKDGRIM FELEQRGASETIADRTIWITHGQDLVNVQSFFLVAESVDMAKMWRTGVNEILKTSRIRHVCPTTQLLKYWKWLTLNVNER RKIPIKVIIKTFSSGKPEKMVQKCLNDLGLGGDKYTPVRVINRSMGKKFRNFYKCSRGRKRKEREELDVEILTFEKFLRL YNKICPRTEVQELFVKLSGQKEYLTKDRLINFLNEEQRDPRLNEILFPFFDPPRTGQLIAKYESDNNYIENGKMSGDAFL RFLMSDENPPVFLDRIEMYMDMDQPLCHYYINSSHNTYLTGRQYGGKSSSEIYRQVLLSGCRCIELDCWDGTGENKGEPI ITHGKAMCTDVFFKDVLVQIRDTAFARSDFPVILSFENHCSKSNQLKMAKYCMDIFGDMLLSKPFDDVPLEPGVSLPSPN RLRKKILIKNKRLKTDIERHQLDQFLREGKLDEEDELNETPEVIGEDSVSPRSGGSGGTNAAEDVAMDDDTSDDDDDPSV QTSLNVMRTVPTVSTTSNNGSNRSARSSLDTPSPSGGLMVPDRASSTATSIKNAVLARSPNFSSLRQKLSFKRRQSPLAG DQRAHPEVEQPISSSSPATPSICGPPPCAPSSASTSSITITTTGCSTSSASGSKPNPGGEMPAKETDEAHPELAKQNFIA KNLKGFGFSKKQPVLTKEEEERIFAEYHYTGATTNIHPLLSSLVNYTHPVKFSGFDVAEVNNLHFHMSSFSESTGLGYLK QSAPEFVNYNKRQPSRIYPKGARVDSSNFLPQIFWNAGCQMVSLNFQTPDVYMQLNMGKFEYNGGSGYLLKPDFLRRPDR TFDPFSESPVDGVIAAHCSVRVISGQFLSDRKIGTYVEVEMYGLPTDTIRKEHKTKVIPGNGLNPVYNEDPFVFRKVVLP ELAVLRFAVYDENGKQLGQRILPLDGLQAGYRHISLRSDTNQSFILSPVLFVQIVIKTYVPDELSGLVDALADPRAFLSE QKKRQEALQHMGVDDSDIPDVPNMKNMALRNMKQPPRQNGSSADLLANNSQPGTARSEQMTSMMSSSTIRSPNEQPAPVA VDKFKVDPIEVDDLRRDKAFAKLLKKFQKDLDDLRKKHQKQRDSIQKQQQTNVDKLITNNRRSTKKEKGSRRSLTASVSS GCGSTSGTVPVGVCSPSGAGPSGSGSGAPSTPGACNSDGTGSPATTGSPVPQDLINNDRVRSLVNTQTGEWSAMVRRHDE EEFELKKGQLKEQFDLLKKLMGEAQKNQMQALKLRLEAEGKDLKQTQTKKSMEDAKVIQLDKGIKTKAERDRRVKELNEK NLKMFVEERKRLAMKAQKHEEQLTKRHLDQLEQLEKDFQKALEVEVGNYKEEQLAAQPTSVVRIILISEEKESRYSSVHS IPPLNLD
view sequence (1447 aa)
>Cbn-EGL-8
MAKEFQFNWKPNIPTPLLQGACFDRYDDESTCLELNAQVRIDEYGFFFNWLVEGKDAVVLDMGQIWEARPGGLPKDGRIM
FELEQRGASETIADRTIWITHGQDLVNVQSFFLVAESVDMAKMWRTGVNEILKTSRIRHVCPTTQLLKYWKWLTLNVNER
RKIPIKVIIKTFSSGKPEKMVQKCLNDLGLGGDKYTPVRVINRSMGKKFRNFYKCSRGRKRKEREELDVEILTFEKFLRL
YNKICPRTEVQELFVKLSGQKEYLTKDRLINFLNEEQRDPRLNEILFPFFDPPRTGQLIAKYESDNNYIENGKMSGDAFL
RFLMSDENPPVFLDRIEMYMDMDQPLCHYYINSSHNTYLTGRQYGGKSSSEIYRQVLLSGCRCIELDCWDGTGENKGEPI
ITHGKAMCTDVFFKDVLVQIRDTAFARSDFPVILSFENHCSKSNQLKMAKYCMDIFGDMLLSKPFDDVPLEPGVSLPSPN
RLRKKILIKNKRLKTDIERHQLDQFLREGKLDEEDELNETPEVIGEDSVSPRSGGSGGTNAAEDVAMDDDTSDDDDDPSV
QTSLNVMRTVPTVSTTSNNGSNRSARSSLDTPSPSGGLMVPDRASSTATSIKNAVLARSPNFSSLRQKLSFKRRQSPLAG
DQRAHPEVEQPISSSSPATPSICGPPPCAPSSASTSSITITTTGCSTSSASGSKPNPGGEMPAKETDEAHPELAKQNFIA
KNLKGFGFSKKQPVLTKEEEERIFAEYHYTGATTNIHPLLSSLVNYTHPVKFSGFDVAEVNNLHFHMSSFSESTGLGYLK
QSAPEFVNYNKRQPSRIYPKGARVDSSNFLPQIFWNAGCQMVSLNFQTPDVYMQLNMGKFEYNGGSGYLLKPDFLRRPDR
TFDPFSESPVDGVIAAHCSVRVISGQFLSDRKIGTYVEVEMYGLPTDTIRKEHKTKVIPGNGLNPVYNEDPFVFRKVVLP
ELAVLRFAVYDENGKQLGQRILPLDGLQAGYRHISLRSDTNQSFILSPVLFVQIVIKTYVPDELSGLVDALADPRAFLSE
QKKRQEALQHMGVDDSDIPDVPNMKNMALRNMKQPPRQNGSSADLLANNSQPGTARSEQMTSMMSSSTIRSPNEQPAPVA
VDKFKVDPIEVDDLRRDKAFAKLLKKFQKDLDDLRKKHQKQRDSIQKQQQTNVDKLITNNRRSTKKEKGSRRSLTASVSS
GCGSTSGTVPVGVCSPSGAGPSGSGSGAPSTPGACNSDGTGSPATTGSPVPQDLINNDRVRSLVNTQTGEWSAMVRRHDE
EEFELKKGQLKEQFDLLKKLMGEAQKNQMQALKLRLEAEGKDLKQTQTKKSMEDAKVIQLDKGIKTKAERDRRVKELNEK
NLKMFVEERKRLAMKAQKHEEQLTKRHLDQLEQLEKDFQKALEVEVGNYKEEQLAAQPTSVVRIILISEEKESRYSSVHS
IPPLNLD
Estimated Isoelectric Point:
8.29012298583984
Estimated Molecular Weight:
162.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr76
Lys110
Gln71
Leu126
Gly91
Met38
Ser126
Tyr33
His23
Glu98
Arg88
Cys21
Phe62
Pro86
Val86
Asn72
Ala72
Ile65
Trp10
Asp93