Sequence:
download
CN26760sequence.fasta
>Cbn-RAD-54 MPPKIFNVGDLVWAKFPGFPPWPAKVVQKDQKRSKMNYTVEYFGSKETGNVKSDEVEDYYEKRERYAKSKRVKGFNEAVE EIEKFIETAVLKLDENLKTACFEACDDSMGSKQGSIVAPEYLQPNHDEQSTSTQLKTPEFSEKEAVYSSFEKLPEDEAKI PDISEYLKERVNTTIVKMPRLESPIAIERARVVVDDDDDFLEILDENDDTVLTESSEPVPVKLKNEAKSKKLEKKESETS IKLVEKRIVEEQVVDNTSEQKSTSFVPDEAVPEILEEQSTSSTKRKREKSPEQASTSSSSSNPAQKRRSLGYSGKTLEVK NIHKSFVSPFSTSVSPSKQGLRRRKKAPPAIEPPVSVEEANPLRFVNIDVFSRRMASESSDHDAMIAKLLSRKFSIPMEG YMLSGRSLGLGGNRRKCALFDPYHEGALILYAPEQLSEHAQLKEDKDRKVHVVADPVVGKILRPHQREGVKFMWDCVTGV NIPEFHGCIMADEMGLGKTLQCISLLWTLLRQSPDACPTVSKSIIVCPSSLVKNWDKEIKKWLGTRLSAMPVDSGKREQI IASLSESSVVLQNKLRFPASFMADSKMRCAIPVLIISYETFRLYANILHSGEVGIVICDEGHRLKNSDNLTYQALSGLKC VRRVLISGTPIQNDLLEYFSLVNFVNPGLLGTASEFRKKFENAILKGRDADASSEDQKKGEEKTKEMVSLVEKCIIRRTS ALLTKYLPVKYEHIICCKNSTLQETLYNKLIECEKQNRIAEKDKGATASALSFITHLKKLCNHPYLVYEEFQKPDNRFRD KCLSAFPESFNPKSFDPSFSGKMKVLDYILAVTRKTTDDKFVLVSNYTQTIDQFMALCKLRGYDFVRLDGSMSIKQRSKI VDTFNDPSSSIFCFLLSSKAGGCGLNLIGANRLVMFDPDWNPANDDQAMARVWRDGQKKTCFIYRLLATGSIEEKMFQRQ THKKALSSCVVDAGEDVARHFSNEQLRELFKLESTVASDTHTKLKCKRCIQGLESVDPPVTADCASDLANWFHSEKNARK VADNVLRAVYECGSISFVFHQKSHNVEAKKVEEKVEELDEDYVPSEAEEDEE
view sequence (1092 aa)
>Cbn-RAD-54
MPPKIFNVGDLVWAKFPGFPPWPAKVVQKDQKRSKMNYTVEYFGSKETGNVKSDEVEDYYEKRERYAKSKRVKGFNEAVE
EIEKFIETAVLKLDENLKTACFEACDDSMGSKQGSIVAPEYLQPNHDEQSTSTQLKTPEFSEKEAVYSSFEKLPEDEAKI
PDISEYLKERVNTTIVKMPRLESPIAIERARVVVDDDDDFLEILDENDDTVLTESSEPVPVKLKNEAKSKKLEKKESETS
IKLVEKRIVEEQVVDNTSEQKSTSFVPDEAVPEILEEQSTSSTKRKREKSPEQASTSSSSSNPAQKRRSLGYSGKTLEVK
NIHKSFVSPFSTSVSPSKQGLRRRKKAPPAIEPPVSVEEANPLRFVNIDVFSRRMASESSDHDAMIAKLLSRKFSIPMEG
YMLSGRSLGLGGNRRKCALFDPYHEGALILYAPEQLSEHAQLKEDKDRKVHVVADPVVGKILRPHQREGVKFMWDCVTGV
NIPEFHGCIMADEMGLGKTLQCISLLWTLLRQSPDACPTVSKSIIVCPSSLVKNWDKEIKKWLGTRLSAMPVDSGKREQI
IASLSESSVVLQNKLRFPASFMADSKMRCAIPVLIISYETFRLYANILHSGEVGIVICDEGHRLKNSDNLTYQALSGLKC
VRRVLISGTPIQNDLLEYFSLVNFVNPGLLGTASEFRKKFENAILKGRDADASSEDQKKGEEKTKEMVSLVEKCIIRRTS
ALLTKYLPVKYEHIICCKNSTLQETLYNKLIECEKQNRIAEKDKGATASALSFITHLKKLCNHPYLVYEEFQKPDNRFRD
KCLSAFPESFNPKSFDPSFSGKMKVLDYILAVTRKTTDDKFVLVSNYTQTIDQFMALCKLRGYDFVRLDGSMSIKQRSKI
VDTFNDPSSSIFCFLLSSKAGGCGLNLIGANRLVMFDPDWNPANDDQAMARVWRDGQKKTCFIYRLLATGSIEEKMFQRQ
THKKALSSCVVDAGEDVARHFSNEQLRELFKLESTVASDTHTKLKCKRCIQGLESVDPPVTADCASDLANWFHSEKNARK
VADNVLRAVYECGSISFVFHQKSHNVEAKKVEEKVEELDEDYVPSEAEEDEE
Estimated Isoelectric Point:
6.61157989501953
Estimated Molecular Weight:
123.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr48
Lys104
Gln35
Leu91
Gly46
Met21
Ser105
Tyr27
His19
Glu98
Arg56
Cys26
Phe47
Pro52
Val80
Asn42
Ala66
Ile54
Trp9
Asp66