Sequence:
download
CN25593sequence.fasta
>Cbn-KLP-7 MIAVGMHVEIKRSDGRIHGAVIAEVKSNGRFMVEWYEKGETKGKESSLDELLKLNPALQPAKPAPVQPPPPPQKALQTST AANRQSMHIQQFPADEEDTFLLDHISMAPSKNVAPNKRQSGIFMQHVPFRPSSPTEKPAPTRRAPSPKPEKTEKSVAPVQ SKPLSTRSGAIPSATNGSSKADTHTITPSPAPVEVPKSVRRSVAVQPVPVVTATAPAPINMGSQRAPSPVARVPSPKNVP RSYPQQEILPSNGNYAFAEMIRNYRAQIDYRPLSMFDSVNENRISVCVRKRPLNKKELTKAEVDVITIPSRDITILHQPQ TRVDLTKYLDNQKFRFDYSFDEYANNELVYRFTAAPLVKTIFDNGNATCFAYGQTGSGKTHTMGGDFSGKKQNAAMGIYA LTARDVFRMLEQPQYRRKDLSVHCAFFEIYGTKTFDLLNEKAELRVLEDKMQKVQVVGLKEEQAMNENDVLELINKGTLV RTAGTTSANANSSRSHAIFQIILRQGKKVWGKFSLIDLAGNERGQDTRECDRDTRKEGANINQSLLALKECIRGMARNSS HVPFRQSKLTMVLRDSFIGEKSRTVMISMISPGISSSDHTLNTLRYADRVKEMGTDGSGEATPIRDEELFIPQSMEKSDD EYDEEIEKQENRRLAVDHLRNLKEMSEKVIQTFISRMQKLIQLTRETITLLSTDPSAAHKAESMAKLDQLAQIIANTRAA VENV
view sequence (724 aa)
>Cbn-KLP-7
MIAVGMHVEIKRSDGRIHGAVIAEVKSNGRFMVEWYEKGETKGKESSLDELLKLNPALQPAKPAPVQPPPPPQKALQTST
AANRQSMHIQQFPADEEDTFLLDHISMAPSKNVAPNKRQSGIFMQHVPFRPSSPTEKPAPTRRAPSPKPEKTEKSVAPVQ
SKPLSTRSGAIPSATNGSSKADTHTITPSPAPVEVPKSVRRSVAVQPVPVVTATAPAPINMGSQRAPSPVARVPSPKNVP
RSYPQQEILPSNGNYAFAEMIRNYRAQIDYRPLSMFDSVNENRISVCVRKRPLNKKELTKAEVDVITIPSRDITILHQPQ
TRVDLTKYLDNQKFRFDYSFDEYANNELVYRFTAAPLVKTIFDNGNATCFAYGQTGSGKTHTMGGDFSGKKQNAAMGIYA
LTARDVFRMLEQPQYRRKDLSVHCAFFEIYGTKTFDLLNEKAELRVLEDKMQKVQVVGLKEEQAMNENDVLELINKGTLV
RTAGTTSANANSSRSHAIFQIILRQGKKVWGKFSLIDLAGNERGQDTRECDRDTRKEGANINQSLLALKECIRGMARNSS
HVPFRQSKLTMVLRDSFIGEKSRTVMISMISPGISSSDHTLNTLRYADRVKEMGTDGSGEATPIRDEELFIPQSMEKSDD
EYDEEIEKQENRRLAVDHLRNLKEMSEKVIQTFISRMQKLIQLTRETITLLSTDPSAAHKAESMAKLDQLAQIIANTRAA
VENV
Estimated Isoelectric Point:
9.29019927978516
Estimated Molecular Weight:
80.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr46
Lys50
Gln37
Leu49
Gly34
Met23
Ser59
Tyr15
His14
Glu49
Arg50
Cys5
Phe24
Pro49
Val46
Asn35
Ala60
Ile41
Trp2
Asp36