Sequence:
download
CN23514sequence.fasta
>Cbn-LIT-1 MGRNQEGQFNGAGNSESAGSSSSSGCSSSSTELYDLAAAHAALISRQQQILNQAIPIIPEHQLAAAAVAAHHHHHQFHPS VQHQLVAAHHNHHHLPQVAHHSVILPRSDVIQQPPHFALHHHLQSLVQQQQQQQAHLHHQQLVGDMALVSHTHPSAVGST TCYEKNQQKQQQVQQIPTQPQVAHVSSNAILAATQQPFYPAAVQDTQPDRPIGYGAFGVVWSVTDPRSGKRVALKKMPNV FQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVLTELMQSDLHKIIVSPQTLTIDHVKVFVYQILRGL KYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRDRLNMTHEVVTQYYRAPELLMGARRYTGAVDIWSVGCIFA ELLQRKILFQAAGPIEQLQMIIDLLGTPSSDAMKYACDGAKNHVLRAGQRPSNAHSLIRLSQQTTEDAVDLLVKLLQFDP DKRISVEEALRHPYLEEGRLRFHSCMCSCCYTKPNMPSRLFANDLDPCHETPFDPKWEKDMSRLSMFELREKMYQFVMDR SPLYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW
view sequence (598 aa)
>Cbn-LIT-1
MGRNQEGQFNGAGNSESAGSSSSSGCSSSSTELYDLAAAHAALISRQQQILNQAIPIIPEHQLAAAAVAAHHHHHQFHPS
VQHQLVAAHHNHHHLPQVAHHSVILPRSDVIQQPPHFALHHHLQSLVQQQQQQQAHLHHQQLVGDMALVSHTHPSAVGST
TCYEKNQQKQQQVQQIPTQPQVAHVSSNAILAATQQPFYPAAVQDTQPDRPIGYGAFGVVWSVTDPRSGKRVALKKMPNV
FQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVLTELMQSDLHKIIVSPQTLTIDHVKVFVYQILRGL
KYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRDRLNMTHEVVTQYYRAPELLMGARRYTGAVDIWSVGCIFA
ELLQRKILFQAAGPIEQLQMIIDLLGTPSSDAMKYACDGAKNHVLRAGQRPSNAHSLIRLSQQTTEDAVDLLVKLLQFDP
DKRISVEEALRHPYLEEGRLRFHSCMCSCCYTKPNMPSRLFANDLDPCHETPFDPKWEKDMSRLSMFELREKMYQFVMDR
SPLYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW
Estimated Isoelectric Point:
7.97417449951172
Estimated Molecular Weight:
67.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr21
Lys22
Gln56
Leu61
Gly24
Met15
Ser50
Tyr16
His37
Glu22
Arg29
Cys13
Phe21
Pro36
Val38
Asn22
Ala54
Ile29
Trp5
Asp27