Sequence:
download
CN21990sequence.fasta
>Cbn-HRP-1 MTDHDIKPENGGGDVNLEPENLRKIFVGGLTSNTTDELMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFTGKTEVDAA MKQRPHVIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFSKYGNVVKSEIILDKATQKPRGFGFV TFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMNKAQMNRDRESRGGRTRDGQRGGYNGGGGGWGGPGGQRGGPGGWG GPGGGAGGQGYGGGTPDYGSGWGGQQGGGQGGWGGPQAQQGGWGGPQQQQGGWGGGGAQQGGWGGPQAQQGGWGGQPQQQ QGGWGGQSGAQQWAQAQGGNRNY
view sequence (343 aa)
>Cbn-HRP-1
MTDHDIKPENGGGDVNLEPENLRKIFVGGLTSNTTDELMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFTGKTEVDAA
MKQRPHVIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFSKYGNVVKSEIILDKATQKPRGFGFV
TFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMNKAQMNRDRESRGGRTRDGQRGGYNGGGGGWGGPGGQRGGPGGWG
GPGGGAGGQGYGGGTPDYGSGWGGQQGGGQGGWGGPQAQQGGWGGPQQQQGGWGGGGAQQGGWGGPQAQQGGWGGQPQQQ
QGGWGGQSGAQQWAQAQGGNRNY
Estimated Isoelectric Point:
8.41904449462891
Estimated Molecular Weight:
36.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr18
Lys17
Gln34
Leu9
Gly81
Met8
Ser15
Tyr8
His6
Glu14
Arg22
Cys2
Phe10
Pro15
Val18
Asn13
Ala12
Ile8
Trp10
Asp23