Sequence:
download
CN21087sequence.fasta
>Cbn-MOG-4 MSIEQFINDQLLTIVGSSDRGVCQYVHALAKQAKNVRDLVDKLRDDAELPMSPAVQSFAEQLFSRLPSKAVTVRQKGPSA AELAEQELKRLNRAVGVLQDDYGASSSKTKNVRKRKESSSEDEAPKTSKKSSKSVKKEEESDESDIEAMEAKLDADIAER DALAARINKKEKERTRNVMEKKREDNKDKEGTSIDKLREESRRQYLRKRKVDKIDELEAIVYDDETLFANEKLTKRERED MKYRKQVLEYAKAHGKAGEVMKIKRYHLPDATSKTVPTEYIEDDEEDHGPGGDGAKWEKEQLMASMLHLGAKDAKKHEQE FELLLDEQIDFIQALQMPGSNEKAEEQQSEAERRKMSIQEVRKSLPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQ YLYEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVGCKLGQQVGYSIRFEDCTSEKTVLKYMTDGMLLREFLNEPDLASY SVMMIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSSFFDDAPIFRIPGRRFPVDIYYTQAPEADYLDA AIVTVMQIHLTQPLPGDILVFLTGQEEIETVQEALMERSKALGSKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLA TNIAETSVTIDGISYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKHELEEQPIP EIQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEK YECSEEIVTIAAMLSCNAAVFYRPKAQVILADTARKGFWSKAGDHITLMNVYNKWCVENYVQHRTMKRARDVRDQLVGLL ERVEIEPKSSKDTVKICKAITAGYFYNVSKLDNTGHYKTVKHKHTTHPHPNSCLFEEMPRWVVYYELVFTSKEFMREMSE IESSWLLEVAPHYYKGRELEDSTNKKMPKQRGKTAKELER
view sequence (1000 aa)
>Cbn-MOG-4
MSIEQFINDQLLTIVGSSDRGVCQYVHALAKQAKNVRDLVDKLRDDAELPMSPAVQSFAEQLFSRLPSKAVTVRQKGPSA
AELAEQELKRLNRAVGVLQDDYGASSSKTKNVRKRKESSSEDEAPKTSKKSSKSVKKEEESDESDIEAMEAKLDADIAER
DALAARINKKEKERTRNVMEKKREDNKDKEGTSIDKLREESRRQYLRKRKVDKIDELEAIVYDDETLFANEKLTKRERED
MKYRKQVLEYAKAHGKAGEVMKIKRYHLPDATSKTVPTEYIEDDEEDHGPGGDGAKWEKEQLMASMLHLGAKDAKKHEQE
FELLLDEQIDFIQALQMPGSNEKAEEQQSEAERRKMSIQEVRKSLPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQ
YLYEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVGCKLGQQVGYSIRFEDCTSEKTVLKYMTDGMLLREFLNEPDLASY
SVMMIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSSFFDDAPIFRIPGRRFPVDIYYTQAPEADYLDA
AIVTVMQIHLTQPLPGDILVFLTGQEEIETVQEALMERSKALGSKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLA
TNIAETSVTIDGISYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKHELEEQPIP
EIQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEK
YECSEEIVTIAAMLSCNAAVFYRPKAQVILADTARKGFWSKAGDHITLMNVYNKWCVENYVQHRTMKRARDVRDQLVGLL
ERVEIEPKSSKDTVKICKAITAGYFYNVSKLDNTGHYKTVKHKHTTHPHPNSCLFEEMPRWVVYYELVFTSKEFMREMSE
IESSWLLEVAPHYYKGRELEDSTNKKMPKQRGKTAKELER
Estimated Isoelectric Point:
6.25717926025391
Estimated Molecular Weight:
113.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr49
Lys89
Gln41
Leu86
Gly49
Met28
Ser62
Tyr33
His24
Glu99
Arg62
Cys13
Phe32
Pro40
Val63
Asn25
Ala85
Ile52
Trp6
Asp62