Sequence:
download
CN19312sequence.fasta
>Cbn-TRXR-2 MLLQSQKHQQVACRLLSTAVQYDLIVIGGGSGGLSCSKRASELGAKVALVDAVVPSPHGTTWGIGGTCANVGCIPKKLMH QAALVGKELKYAETYGWNGLDKTKITHDWRILSKTVNDRIKGNNWVYRVQLRDKGIKYYNAFAEFVENGQVLVSGVDKNK TKTLLTAPNIVISTGLRPRYPNVPGETLGISSDDLFTLPKPPGKTLVVGAGYVALECAGFLAGLNQNVEVLIRSSPLKEF DKDCVNFVMEHLKSTGVKIREHVEVASVEETENKKKKVHFTGNGGTDEYDTVIWATGRTPRTDSLKLETVGVKKNEKSGK IVADDFDKTNIDGIFAVGDVVEGRQELTPLAIQSGKLLADRLFSDSKQTVRFDGVATTVFTPLELSTVGLTEEEAKKQYG EDGIEVFHSHFTPFEYIVPQNKDSEFCYVKAICLRDETQKVVGLHFVGPNAAEVMQGYAVAFRVGISISDLQLTIAIHPC SSEEFVKLQVTKRSGKDPRVQGCCG
view sequence (505 aa)
>Cbn-TRXR-2
MLLQSQKHQQVACRLLSTAVQYDLIVIGGGSGGLSCSKRASELGAKVALVDAVVPSPHGTTWGIGGTCANVGCIPKKLMH
QAALVGKELKYAETYGWNGLDKTKITHDWRILSKTVNDRIKGNNWVYRVQLRDKGIKYYNAFAEFVENGQVLVSGVDKNK
TKTLLTAPNIVISTGLRPRYPNVPGETLGISSDDLFTLPKPPGKTLVVGAGYVALECAGFLAGLNQNVEVLIRSSPLKEF
DKDCVNFVMEHLKSTGVKIREHVEVASVEETENKKKKVHFTGNGGTDEYDTVIWATGRTPRTDSLKLETVGVKKNEKSGK
IVADDFDKTNIDGIFAVGDVVEGRQELTPLAIQSGKLLADRLFSDSKQTVRFDGVATTVFTPLELSTVGLTEEEAKKQYG
EDGIEVFHSHFTPFEYIVPQNKDSEFCYVKAICLRDETQKVVGLHFVGPNAAEVMQGYAVAFRVGISISDLQLTIAIHPC
SSEEFVKLQVTKRSGKDPRVQGCCG
Estimated Isoelectric Point:
7.90399932861328
Estimated Molecular Weight:
55.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr36
Lys42
Gln19
Leu43
Gly48
Met4
Ser29
Tyr13
His11
Glu32
Arg19
Cys11
Phe19
Pro19
Val53
Asn19
Ala31
Ile25
Trp5
Asp27