Sequence:
download
CN14451sequence.fasta
>Cbn-DCS-1 MKRAAENEPTEQERTEESSQEWLKKAKFQEVLGADSSHKSLFLLLSQPDGSQGILLANKSPFSEDKSDIEKLLETAKLHE ISRNDIFGSYNIEVDGQLNLLKSQLIYPVNERLIAKYRQEEKYVIRETPELYEKVTKPYIEKFQLNLNWVYNCLEKRSEV DKIVFEDPDKNNGFLLMQDIKWDGKTLENLYVLAIIHRHGLKSVRDLTGDHLQMLYNIRDKSLKAINEKYGLRTDQIKCY FHYQPSFYHLHVHFINLKYDAPASTTMSAILLDDVINNLELNSEHYKKSTLTFTRKHGDKLTEMFHEANVI
view sequence (311 aa)
>Cbn-DCS-1
MKRAAENEPTEQERTEESSQEWLKKAKFQEVLGADSSHKSLFLLLSQPDGSQGILLANKSPFSEDKSDIEKLLETAKLHE
ISRNDIFGSYNIEVDGQLNLLKSQLIYPVNERLIAKYRQEEKYVIRETPELYEKVTKPYIEKFQLNLNWVYNCLEKRSEV
DKIVFEDPDKNNGFLLMQDIKWDGKTLENLYVLAIIHRHGLKSVRDLTGDHLQMLYNIRDKSLKAINEKYGLRTDQIKCY
FHYQPSFYHLHVHFINLKYDAPASTTMSAILLDDVINNLELNSEHYKKSTLTFTRKHGDKLTEMFHEANVI
Estimated Isoelectric Point:
6.08446502685547
Estimated Molecular Weight:
36.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys30
Gln13
Leu39
Gly11
Met5
Ser21
Tyr15
His12
Glu29
Arg12
Cys2
Phe12
Pro9
Val13
Asn19
Ala13
Ile20
Trp3
Asp19