Sequence:
download
CN14372sequence.fasta
>Cbn-UNC-43 MMNACTKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQE ESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHTNGIVHRDLKPENLLLASKAKGAAVKLADFGLAI EVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTP EAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKGAILTTMIATRNLSNLGRNLLN KKEQGPPSTIKESSESSQTIDDNDSEKAQKQDIVRVTQTLLDAISCKDFDTYTRLCDSSMTCFEPEALGNLIEGIEFHRF YFDGNRKNQVHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQESRVWSKKQGRWVCVHVHRSTQPSTNTTVS EF
view sequence (482 aa)
>Cbn-UNC-43
MMNACTKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQE
ESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHTNGIVHRDLKPENLLLASKAKGAAVKLADFGLAI
EVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTP
EAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKGAILTTMIATRNLSNLGRNLLN
KKEQGPPSTIKESSESSQTIDDNDSEKAQKQDIVRVTQTLLDAISCKDFDTYTRLCDSSMTCFEPEALGNLIEGIEFHRF
YFDGNRKNQVHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQESRVWSKKQGRWVCVHVHRSTQPSTNTTVS
EF
Estimated Isoelectric Point:
6.96320343017578
Estimated Molecular Weight:
54.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr30
Lys35
Gln20
Leu40
Gly23
Met6
Ser32
Tyr14
His16
Glu32
Arg27
Cys13
Phe19
Pro18
Val31
Asn22
Ala37
Ile29
Trp7
Asp31