Sequence:
download
CN13058sequence.fasta
>Cbn-SUP-12 MYGQVHDPLVAAAALAQSTNAEPVVGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVT MKDKASADRACKDPNPIIDGRKANVNLAYLGAKPRTNVQLAALATGQVQLPLTTQLQALFPPRIGIPQMYYPAVTGFNPL IASQGAAAQQQLIDYSALAAVMGQNPQAAYGIPSQGKFASQPTIEQYAAYPAGYGLVPQAAYNLGNSQLQLAAAQQQLEH QRV
view sequence (243 aa)
>Cbn-SUP-12
MYGQVHDPLVAAAALAQSTNAEPVVGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVT
MKDKASADRACKDPNPIIDGRKANVNLAYLGAKPRTNVQLAALATGQVQLPLTTQLQALFPPRIGIPQMYYPAVTGFNPL
IASQGAAAQQQLIDYSALAAVMGQNPQAAYGIPSQGKFASQPTIEQYAAYPAGYGLVPQAAYNLGNSQLQLAAAQQQLEH
QRV
Estimated Isoelectric Point:
6.90029144287109
Estimated Molecular Weight:
26.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys9
Gln26
Leu20
Gly19
Met5
Ser10
Tyr13
His4
Glu7
Arg8
Cys1
Phe8
Pro17
Val15
Asn10
Ala36
Ile11
Asp10