Sequence:
download
CN12516sequence.fasta
>Cbn-CED-7 MNKLRQFSLLLWKDWILLRRNKVWTLFELIIPCLLLGPLVYLVVKNADSTASPENLYDSFKLTGTVEDVFLEYTFMKPIY RRWCLRSDVIFGYTCKDPAAKAIVDDIMQKVSGRFQSSKLKMSVKNEESEDQLLQVLRDDLPLSNETFCPVNSFVGGIVF DTVDLPHKILRYRILLGKATEEVWHLTENSFNPYGPQSGRGGRIPSSPPYWSAAYLTLQHAVETSFVSSAQSESKDSSIT FRGLPEPRYKTSSVSAFIDLFPFIWAFVTFINVIHITREIAAENGAVKPYLTAMGLSTFMFYAAHVVMAFIKFFIIFVFS VIPLAFVMEFVSPAALILTVLMYGLGAVIFGAFIASFFDNTNSAIKAILVAWGAMIGISYKFRPDIDQISSCFLYGLNIN GAFALAVEAISDYMRRERELNILNMFNDSTLHFSLGWALVMMIVDILWMSAAALVVDHIRTSSDFSLRALFTRGDVLEEY ENQTDGVTAYNTRINEQMNPMGTSSLRPTTADSDALLEGSTEIDGARDTARADISVGRLVKIWSSTGERAVDGLSLRAVR GQCSVLLGHNGAGKSTTFSSIAGIIKPTYGHISICGHDVGTEPEKTRNHIGMCPQYNPLYDKLTVSEHLQLVHGLKGARK HEFKEEMKRLLNDVKLDFKENERAMNLSGGMKRKLCVCMALIGDSEVVLLDEPTAGMDPGARQDVQKLIEREKANRTILL TTHYMDEAERLGDWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVLDHNGEKRKMTEVLTSICTHFVEGAERGEMHGQQI EIILPEVEKKSFVPLFQALEAIQDRNFRSNALDSVPNQLKSQLAVLVMKSFGLSLNTLEQVFITIGDKVDKAIASRQNSR ISHHSRNTSEPSLKPPGYDTQSSTKSFDSYQKLMDSQARGPDMSGSSKVASQFAAILRKKLLYSVRNWTQLFGQVLIPII LLGLVASLSTLKSNNSDQYRSLSTYGIEPSKVVWRFDDDGTIPEEATKFESLLNKSSGFQVLKYSEKNTLLNITTSLIGE MPPASIGMTQSKTPGIIETLFNVRYYHVLPTVVSMINRARLSVDSQIEGGVFLYSKSTSDTNLLPSQLIDVLLTPMLILI FAMVTSTFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYTLICMIFLGMFLLFNWMYNHLAIVILFWILYFFS SVPFIYAVSFLFQSPSKANVMLIIWQVVISGAALVAVFVIFMLFDIDPTLKSFLMNGFLFLLPSYAFGSAIITINTYGFI ITSEELMKWDHCGKNAVLMFAFGVCSFILFVLLQFKFVRRFLSQVWTIRRSAHNNVQPMMGDLPVCPSVEEERNRVHNAN PQNLALAVKDLTKTFGRFTALNELCLAVDQKECFGLLGVNGAGKTTTFNILTGQSFATSGEATIGGHDVTEHISIGYCPQ FDALMLDLTGRESLEILAQMHGFSDYKAKAELILECVGMQAHADKLVRFYSGGQKRKISVGVALLAPTQMIILDEPTAGI DPKARREVWELLLWCREHSNSALMLTSHSMDECEALCSRIAVLNRGSLIAIGSSQELKSLYGNNYTMTLTLYEPAQRDVV VQLVAARLPNSILKTTPTNKTLNLKWQIPKEKNDCWSEKFEMVQNLAKDFGVKDFILAQSSLEETFLRLAGLDEDQMDTH STVNVTHSTHV
view sequence (1691 aa)
>Cbn-CED-7
MNKLRQFSLLLWKDWILLRRNKVWTLFELIIPCLLLGPLVYLVVKNADSTASPENLYDSFKLTGTVEDVFLEYTFMKPIY
RRWCLRSDVIFGYTCKDPAAKAIVDDIMQKVSGRFQSSKLKMSVKNEESEDQLLQVLRDDLPLSNETFCPVNSFVGGIVF
DTVDLPHKILRYRILLGKATEEVWHLTENSFNPYGPQSGRGGRIPSSPPYWSAAYLTLQHAVETSFVSSAQSESKDSSIT
FRGLPEPRYKTSSVSAFIDLFPFIWAFVTFINVIHITREIAAENGAVKPYLTAMGLSTFMFYAAHVVMAFIKFFIIFVFS
VIPLAFVMEFVSPAALILTVLMYGLGAVIFGAFIASFFDNTNSAIKAILVAWGAMIGISYKFRPDIDQISSCFLYGLNIN
GAFALAVEAISDYMRRERELNILNMFNDSTLHFSLGWALVMMIVDILWMSAAALVVDHIRTSSDFSLRALFTRGDVLEEY
ENQTDGVTAYNTRINEQMNPMGTSSLRPTTADSDALLEGSTEIDGARDTARADISVGRLVKIWSSTGERAVDGLSLRAVR
GQCSVLLGHNGAGKSTTFSSIAGIIKPTYGHISICGHDVGTEPEKTRNHIGMCPQYNPLYDKLTVSEHLQLVHGLKGARK
HEFKEEMKRLLNDVKLDFKENERAMNLSGGMKRKLCVCMALIGDSEVVLLDEPTAGMDPGARQDVQKLIEREKANRTILL
TTHYMDEAERLGDWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVLDHNGEKRKMTEVLTSICTHFVEGAERGEMHGQQI
EIILPEVEKKSFVPLFQALEAIQDRNFRSNALDSVPNQLKSQLAVLVMKSFGLSLNTLEQVFITIGDKVDKAIASRQNSR
ISHHSRNTSEPSLKPPGYDTQSSTKSFDSYQKLMDSQARGPDMSGSSKVASQFAAILRKKLLYSVRNWTQLFGQVLIPII
LLGLVASLSTLKSNNSDQYRSLSTYGIEPSKVVWRFDDDGTIPEEATKFESLLNKSSGFQVLKYSEKNTLLNITTSLIGE
MPPASIGMTQSKTPGIIETLFNVRYYHVLPTVVSMINRARLSVDSQIEGGVFLYSKSTSDTNLLPSQLIDVLLTPMLILI
FAMVTSTFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYTLICMIFLGMFLLFNWMYNHLAIVILFWILYFFS
SVPFIYAVSFLFQSPSKANVMLIIWQVVISGAALVAVFVIFMLFDIDPTLKSFLMNGFLFLLPSYAFGSAIITINTYGFI
ITSEELMKWDHCGKNAVLMFAFGVCSFILFVLLQFKFVRRFLSQVWTIRRSAHNNVQPMMGDLPVCPSVEEERNRVHNAN
PQNLALAVKDLTKTFGRFTALNELCLAVDQKECFGLLGVNGAGKTTTFNILTGQSFATSGEATIGGHDVTEHISIGYCPQ
FDALMLDLTGRESLEILAQMHGFSDYKAKAELILECVGMQAHADKLVRFYSGGQKRKISVGVALLAPTQMIILDEPTAGI
DPKARREVWELLLWCREHSNSALMLTSHSMDECEALCSRIAVLNRGSLIAIGSSQELKSLYGNNYTMTLTLYEPAQRDVV
VQLVAARLPNSILKTTPTNKTLNLKWQIPKEKNDCWSEKFEMVQNLAKDFGVKDFILAQSSLEETFLRLAGLDEDQMDTH
STVNVTHSTHV
Estimated Isoelectric Point:
6.39817047119141
Estimated Molecular Weight:
189.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr105
Lys84
Gln60
Leu194
Gly102
Met55
Ser144
Tyr47
His36
Glu89
Arg73
Cys24
Phe99
Pro61
Val117
Asn71
Ala113
Ile115
Trp23
Asp79