Sequence:
download
CN11669sequence.fasta
>Cbn-DOP-3 MLAGQHHVPGIDSPLMVVLWRVAAGVFLPLIPTMAVFGNALVIMSVFRERSLQTVTNMLIVSLAVSDLMVAIGVMSFGVY YEWNSFKWGLGAFFCHVYQALDVACSTASILNLLAISLDRYIAIGHPISYAQYGARGGRAMISITIVWGVSIAVALPLLL GVNPMENDQCELANPYFNMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSETDKISSALLGGAQIARQMGK HFKNRTDQILLEISFQTSSFPTMSESSDDGSTISPMINSFNNFLPKKTTYPSTSIPAIPECGSMPNLTIIEKPEEEKDIE LSIMDLRDTVEMLDDKYSSAMITRSFGEELEEILPFIDGSTSVKHSREQLHTTRSNTSTTRLLDVKPELRSISVPSIQDE KKISQNSTQVPFAHQNGTNKQKLLPNPGQLMKSKSTTLLKTNGYMDTDSLNNNRSSHKRSLADLLPHDEFSFSDSMRVYK NRLFKSLSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLPFFILHLSNSICLILHPDSDCVGFLPL YLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILSCGIFKKR
view sequence (601 aa)
>Cbn-DOP-3
MLAGQHHVPGIDSPLMVVLWRVAAGVFLPLIPTMAVFGNALVIMSVFRERSLQTVTNMLIVSLAVSDLMVAIGVMSFGVY
YEWNSFKWGLGAFFCHVYQALDVACSTASILNLLAISLDRYIAIGHPISYAQYGARGGRAMISITIVWGVSIAVALPLLL
GVNPMENDQCELANPYFNMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSETDKISSALLGGAQIARQMGK
HFKNRTDQILLEISFQTSSFPTMSESSDDGSTISPMINSFNNFLPKKTTYPSTSIPAIPECGSMPNLTIIEKPEEEKDIE
LSIMDLRDTVEMLDDKYSSAMITRSFGEELEEILPFIDGSTSVKHSREQLHTTRSNTSTTRLLDVKPELRSISVPSIQDE
KKISQNSTQVPFAHQNGTNKQKLLPNPGQLMKSKSTTLLKTNGYMDTDSLNNNRSSHKRSLADLLPHDEFSFSDSMRVYK
NRLFKSLSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLPFFILHLSNSICLILHPDSDCVGFLPL
YLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILSCGIFKKR
Estimated Isoelectric Point:
9.28881072998047
Estimated Molecular Weight:
67.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr35
Lys28
Gln21
Leu66
Gly28
Met23
Ser65
Tyr15
His14
Glu24
Arg35
Cys9
Phe32
Pro30
Val33
Asn29
Ala36
Ile46
Trp7
Asp25