Sequence:
download
CN11535sequence.fasta
>Cbn-GPA-16 MGCIMSQEDEAAKRRSKKIDRLLREDAESSNRTVKLLLLGAGESGKSTILKQMRIIHDVGYTTEERKVFRGVVYGNIILS LNAIIKAMAQLEIAFDTQDHEADARKLLMFSTTGEEDELPEELVVLMKSVWSDDGIQKALARSREYQLNDSAAYYLSQLD RICAPNYVPTQDDILRTRIKTTGIVETQFVYKDRLFLVFDVGGQRSERKKWIHCFEDVTALIFCVAMSEYDMVLVEDCQT NRMRESLKLFDSICNNKWFTETSIILFLNKKDLFEEKIVRSPLTHCFPEYTGANNYEEASAYIQQQFEEVNKRTVGQKTQ EIYTQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGLY
view sequence (357 aa)
>Cbn-GPA-16
MGCIMSQEDEAAKRRSKKIDRLLREDAESSNRTVKLLLLGAGESGKSTILKQMRIIHDVGYTTEERKVFRGVVYGNIILS
LNAIIKAMAQLEIAFDTQDHEADARKLLMFSTTGEEDELPEELVVLMKSVWSDDGIQKALARSREYQLNDSAAYYLSQLD
RICAPNYVPTQDDILRTRIKTTGIVETQFVYKDRLFLVFDVGGQRSERKKWIHCFEDVTALIFCVAMSEYDMVLVEDCQT
NRMRESLKLFDSICNNKWFTETSIILFLNKKDLFEEKIVRSPLTHCFPEYTGANNYEEASAYIQQQFEEVNKRTVGQKTQ
EIYTQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGLY
Estimated Isoelectric Point:
5.24684906005859
Estimated Molecular Weight:
41.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys22
Gln17
Leu32
Gly15
Met9
Ser20
Tyr13
His4
Glu30
Arg24
Cys9
Phe17
Pro5
Val22
Asn15
Ala22
Ile27
Trp3
Asp25