Sequence:
download
CN09483sequence.fasta
>Cbn-HRP-2 MSEEVKQEVKQEADETKAAVAVTEAAGTEATGETTSEEPEAATTGTTAAAATAEATNGAKQENGNSNEPSKYIDTDNYKK LIGQKMKPAIADLVCQIFESGLFTPEDLDDRAIDIINSVSLEQAKFIFTEIKNSELFGVATKSLYVTSLIRSFKDRCRQQ GAAAVTSGKLINGPELESVKKLVADSGYNLEVTIGQRKYGGPPPDWDGPITGPVGQGHEIYVGHIPNDIFEDTLVPLFEK SGKIWDLRLMMDPMTGASRGYAFVTYCEKEHAANAAKTYDGHEISTGKPLKVNVSIANTRLFLGNIPKTKSKDEILEELK THAEGVTDVIVYSVPDNDKIRNRGFCFVDFIDHKTASDIKRKIAQHKIRPFNADVYVDWAEHQEEPDEDTMSKVKVLYIR NIKEAVTEEKLTEIFKEYASLDRVKKVKDYAFIHFNEREDCMKAMEQWNGKELEGTVVEASLAKPPQEKKKKPAMRGRGF GSGGGGGGGGNQGQRGGNHHRGGGGGGGNYGNQQGGYYQNYGFNNGYDMPMPWGGPGYGGDMGYGGYGGYGGYGGGYGGP APYGDFGGGFRGGARGSPRGGGFRGGPPGRGGMANRRGRGKRPGDGRGGPASKRDNGKPDFSADVNMSTF
view sequence (630 aa)
>Cbn-HRP-2
MSEEVKQEVKQEADETKAAVAVTEAAGTEATGETTSEEPEAATTGTTAAAATAEATNGAKQENGNSNEPSKYIDTDNYKK
LIGQKMKPAIADLVCQIFESGLFTPEDLDDRAIDIINSVSLEQAKFIFTEIKNSELFGVATKSLYVTSLIRSFKDRCRQQ
GAAAVTSGKLINGPELESVKKLVADSGYNLEVTIGQRKYGGPPPDWDGPITGPVGQGHEIYVGHIPNDIFEDTLVPLFEK
SGKIWDLRLMMDPMTGASRGYAFVTYCEKEHAANAAKTYDGHEISTGKPLKVNVSIANTRLFLGNIPKTKSKDEILEELK
THAEGVTDVIVYSVPDNDKIRNRGFCFVDFIDHKTASDIKRKIAQHKIRPFNADVYVDWAEHQEEPDEDTMSKVKVLYIR
NIKEAVTEEKLTEIFKEYASLDRVKKVKDYAFIHFNEREDCMKAMEQWNGKELEGTVVEASLAKPPQEKKKKPAMRGRGF
GSGGGGGGGGNQGQRGGNHHRGGGGGGGNYGNQQGGYYQNYGFNNGYDMPMPWGGPGYGGDMGYGGYGGYGGYGGGYGGP
APYGDFGGGFRGGARGSPRGGGFRGGPPGRGGMANRRGRGKRPGDGRGGPASKRDNGKPDFSADVNMSTF
Estimated Isoelectric Point:
6.10070037841797
Estimated Molecular Weight:
67.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr35
Lys50
Gln19
Leu26
Gly95
Met14
Ser29
Tyr26
His11
Glu48
Arg30
Cys5
Phe24
Pro32
Val33
Asn30
Ala49
Ile31
Trp5
Asp38